(data stored in ACNUC7421 zone)

EMBL: CP000031.PE404

CP000031.PE404       Location/Qualifiers
FT   CDS_pept        complement(424229..425440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0413"
FT                   /product="Cys/Met metabolism PLP-dependent enzyme family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93731"
FT                   /db_xref="GOA:Q5LWC9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC9"
FT                   /protein_id="AAV93731.1"
FT                   /translation="MTKTNRPAGPMTTAIHAGEAPDPATLASAPPIHMSSTYVSEDVLG
FT                   FSAHDLTPQSPYAYSRWANPTVAMLEAKIAAMQGTEACLCTASGMAAAAAIFFTFLSAG
FT                   DHVIVSDVSYAGVAELARDTLPRMGIAVSTVDMSDLAAVAAAIRPETRLIHTETPVNPI
FT                   GRLTDLAAISALARQAGALLSCDATFASPLGMDTVALGVDLTMHSVTKYICGHGDAVAG
FT                   AVCGRADLVSRMRVEAAIHHGGVLSPFNAWLIARGAATLPLRMKAHAAGAHAVAEWLEA
FT                   DPRVGRVIYPGLPSHPQAELAARQMSNMSAMISFQVGDAATGERLARQMIERLEVIHYA
FT                   VSLGHHRSLIFWMGTEGLMETSFRLEGAQLEAYRAYAGDGIFRLSVGLEDPEDLIADLD
FT                   RAIA"
     atgacaaaga ccaaccgccc ggcgggcccg atgaccaccg caattcacgc cggagaggcc        60
     ccggatccgg caacgctggc ctcggcaccg ccgatccaca tgtcctcgac ctatgtgtcc       120
     gaggatgtgc tgggcttctc tgcccatgac ctgacgccgc aaagccccta tgcctattcg       180
     cgctgggcca atccaaccgt cgcgatgctc gaggccaaga tcgccgcgat gcagggaacc       240
     gaggcctgcc tgtgcaccgc gtcgggcatg gcggcggcgg cggcgatctt cttcaccttc       300
     ctgtcggcag gcgatcatgt gatcgtatcc gatgtctctt atgcgggcgt ggcggaactg       360
     gcgcgcgaca cgctgccccg gatggggatc gcggtcagca ccgtggacat gtccgacctt       420
     gccgccgtgg cggcggcgat ccggcccgag accaggctga tccataccga aacgccggtg       480
     aacccgatcg ggcggctgac cgacctggcc gcgatctcgg ccctggcacg gcaggcaggc       540
     gcgctgttga gctgtgacgc cacctttgcc tcgcccctgg gaatggacac ggttgcactg       600
     ggcgtcgatc tgaccatgca ttcggtcacc aaatacatct gcggccatgg cgatgcggtg       660
     gcgggtgcgg tctgtggccg ggccgatctg gtctcgcgga tgcgggtcga ggcggcgatc       720
     catcacggcg gggtgctgtc acccttcaac gcctggctga tcgcgcgcgg cgccgccacg       780
     ctgccgctca ggatgaaggc gcatgcggcg ggcgcacatg cggtggccga gtggctggag       840
     gccgatcccc gcgtcggtcg ggtgatctat cccggcctgc catcacatcc gcaggcggag       900
     cttgccgcgc ggcagatgtc gaacatgtcg gcgatgatct cgttccaggt gggcgatgcc       960
     gccacgggcg aacgcctggc ccggcagatg atcgagcggc ttgaggtgat ccattatgcc      1020
     gtgtctctgg gccatcaccg cagcctgatc ttctggatgg ggaccgaggg gctgatggaa      1080
     acctcgttcc ggctggaggg cgcccaactg gaagcctatc gcgcctatgc gggcgacggg      1140
     attttccgcc tgtcggtggg gctggaagac cccgaggacc tgatcgccga tctggatcgg      1200
     gcgatcgcct aa                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page