(data stored in ACNUC7421 zone)

EMBL: CP000031.PE405

CP000031.PE405       Location/Qualifiers
FT   CDS_pept        425562..427577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0414"
FT                   /product="peptidyl-dipeptidase, putative"
FT                   /note="identified by similarity to SP:P27236; match to
FT                   protein family HMM PF01432"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93732"
FT                   /db_xref="GOA:Q5LWC8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC8"
FT                   /protein_id="AAV93732.1"
FT                   /translation="MTNPILADWQTPFDIAPFDRIADSDFAPALEVALAEHRAEIAAIA
FT                   DSPEAPTFANVIEALEAAGGALDRVLGVFFTVAGADSNPAREELQRAFSPQLAAHFSEI
FT                   SANKALFARVAAVWEARADLELSDEQQRVLMLTHRGFVRAGAALSGEAEARMKEIKARL
FT                   AVLGTEFTQNLLADERDWFMDLSEDDLEGLPDFVTAAARAAGQEKEAAGPVVTLSRSLI
FT                   VPFLQFSPRRDLRERAYRAWVARGANGGKTDNRAIATETLTLRQERAALLGYDSFAAYK
FT                   LETEMARSPDRVRDLLMQVWAPARARAEADAEVLTAMMQEDGINGPLEPWDWHYYAARR
FT                   RKAEHDLDEAALKPYLQLDRMIEASFACANRLFGLEFRPLDIALYHPDCRAWEVTRDGR
FT                   HVAVFIGDYFARGSKRSGAWCSAMRAQAKFPRTQAPVVINVCNFAKGDPALLSYDDART
FT                   LFHEFGHALHQMLSDVTYESVSGTSVARDFVELPSQLYEHWLEVPEVLAEFATHAETGA
FT                   PMPAEMLEKVLGAANFDQGFQTVEYVASALVDLAFHDGPAPSDPMAKQAEVLAELGMPH
FT                   AIGMRHATPHFAHVFAGDGYSSGYYSYMWSEVMDADAFAAFEEAGGAFDPDRAEALERH
FT                   ILSTGGSRDAEDLYLAFRGRLPGVEALLKGRGLIAA"
     atgaccaatc ccatccttgc cgactggcag accccgttcg acatcgcccc gttcgaccgg        60
     atcgcagaca gcgatttcgc cccggcgctg gaggtggcgc tggccgaaca ccgggccgag       120
     atcgccgcca tcgccgacag ccccgaggcg ccgacctttg ccaatgtgat cgaggcgctc       180
     gaggcggcag gcggcgcgct ggaccgggtg ctgggcgtgt tctttaccgt ggcgggtgcg       240
     gacagcaatc cggcgcgcga agaattgcag cgcgcgttct cgccccagct ggcggcgcat       300
     ttttccgaga tttcggccaa caaggcgctg ttcgcccgcg tcgccgccgt gtgggaggcg       360
     cgcgcggatc tcgaactgag cgacgaacag cagcgggtgc tgatgctgac ccatcgtggc       420
     tttgtccgtg cgggcgcggc gctcagcggt gaggctgaag cgcggatgaa agagatcaag       480
     gcgcgactgg cggtgctggg taccgaattc acccagaacc tgctggcgga cgagcgcgac       540
     tggttcatgg acctgtccga ggacgatctg gaggggctgc ctgatttcgt caccgccgcc       600
     gcccgcgcgg cggggcaaga aaaagaggcc gcaggcccgg tggtgaccct gtcgcgctcg       660
     ctgatcgtgc cgttcctgca attctcgccg cgccgcgatc tgcgtgagcg ggcctatcgc       720
     gcctgggtgg cgcgtggggc caatggcggc aagaccgaca accgcgccat cgcgaccgag       780
     accctgaccc tgcgccagga gcgcgcggcg ctattgggct atgacagttt cgccgcatac       840
     aagctggaaa ccgagatggc gcgtagcccc gaccgggtgc gcgatctctt gatgcaggtc       900
     tgggcacccg cccgcgcgcg ggccgaggcg gatgccgagg tgctgacggc gatgatgcag       960
     gaggacggga tcaacggccc gctggaaccc tgggactggc actattacgc ggcacggcgg      1020
     cgcaaggccg agcatgatct ggatgaagcg gcgctgaaac cctatctgca gctcgaccgc      1080
     atgatcgagg cgtcctttgc ctgtgccaac cgcctgttcg ggctggagtt ccgcccgctc      1140
     gacatcgcgc tctatcaccc cgattgccgg gcctgggagg tgacacggga tggtcggcat      1200
     gtggccgtct ttatcggcga ctatttcgcg cgcggctcga aacgctcggg cgcctggtgc      1260
     tcggcgatgc gggcgcaggc gaagttcccg cgcacccagg cgccggtggt gatcaacgtc      1320
     tgcaacttcg ccaagggcga tccggcgctg ctgagctatg atgacgcgcg cactctgttt      1380
     catgaattcg gccacgcgct gcaccagatg ctgtcggatg tgacctatga aagcgtgtcg      1440
     ggcacatcgg tcgcgcgcga tttcgtggaa ctgcccagcc agctttacga gcattggctg      1500
     gaggtgcccg aggtgctggc cgagttcgcc acccatgccg agaccggtgc gccgatgccc      1560
     gccgagatgc tggaaaaggt gttgggcgcg gccaattttg accaagggtt ccagacggtg      1620
     gaatatgtcg cctcggccct ggtggacctg gcgtttcacg acggcccggc gccgtctgat      1680
     ccgatggcga aacaggccga ggtgctggcg gagctgggga tgccccatgc catcggcatg      1740
     cggcacgcca ccccgcattt cgcgcatgtc tttgccggtg atggctatag ctcgggctat      1800
     tacagctata tgtggtccga ggtgatggat gccgacgcct ttgccgcgtt cgaggaggcg      1860
     ggcggtgcct ttgacccgga ccgggccgaa gcgctggagc ggcatatcct gtcgacaggc      1920
     gggtcgcgcg atgccgagga cctctatctg gccttccggg gccgcttgcc gggggtcgag      1980
     gccctgctca aaggccgcgg attgatcgcg gcctga                                2016
//

If you have problems or comments...

PBIL Back to PBIL home page