(data stored in ACNUC7421 zone)

EMBL: CP000031.PE406

CP000031.PE406       Location/Qualifiers
FT   CDS_pept        complement(427642..428574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0415"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93733"
FT                   /db_xref="GOA:Q5LWC7"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC7"
FT                   /protein_id="AAV93733.2"
FT                   /translation="MPANVLFSARSELWPVYQPLISTYLREMGIDFDLRRDFPPEEVDY
FT                   VVYAPNGGLRDFTPFTRLKAVLSLWAGVESIADNPTLTVPLARMVDHGLTQGMTEWVVG
FT                   HVLRYHLGMDAHIHGLNGDWRQDVPPLASQRQVTILGLGALGEAAARALSALGFQVTGW
FT                   SRSPKELPGIACLHGPDGLDQALARAEILVLLLPSTAATENTLNTQTLARLPRGARIIN
FT                   PGRGPLIDDDALLAALDSGQVGHATLDVFRIEPLPRDHPYWGHPNVTVTPHIASETRPE
FT                   TAAQVICENIRRGESGEMFLHLVDRSLGY"
     atgcccgcaa atgtgctctt ttccgcgcgt tccgaacttt ggcccgtcta tcagccgctg        60
     atctcgacct atctccgtga aatgggcatc gactttgacc tgcgcagaga cttcccaccg       120
     gaggaggtcg actatgtcgt ctatgccccc aatggcggcc tgcgcgattt cacccccttc       180
     acccggctca aggcggtgtt gagcctctgg gccggggtcg agagcatcgc ggacaatccc       240
     accctgacgg tgcccttggc gcggatggtc gatcacgggc tgacccaggg catgaccgaa       300
     tgggtggtgg ggcatgtgct gcgctaccat ctcgggatgg atgcccatat ccacgggctg       360
     aacggcgact ggcgccagga cgtgccacca ctggccagcc agaggcaggt caccatcctg       420
     ggcctcggcg cgctgggaga ggccgccgcg cgcgccctga gcgcactcgg cttccaggtc       480
     acggggtgga gcagatcgcc caaggaactg cccggcatcg cctgcctgca tgggccggac       540
     gggctggacc aggcgctggc ccgcgccgaa atcctcgttc tgctgctgcc cagcacagcg       600
     gcaaccgaaa acacgcttaa tacccaaacg ctggcccgcc taccccgggg cgcccgcatc       660
     atcaatcccg gacgcgggcc gctgatcgac gacgacgccc tgcttgccgc gcttgacagc       720
     gggcaggtgg gccatgcgac gctcgatgtg ttccgcatcg aaccgctgcc ccgcgatcat       780
     ccctattggg gacatcccaa tgtcaccgtc accccgcata tcgcctcgga aacccgtccc       840
     gaaacggcag cacaggtgat ctgcgagaat attcgccggg gcgaaagcgg cgagatgttc       900
     ctgcacctgg tcgaccgcag cctcggctat tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page