(data stored in ACNUC7421 zone)

EMBL: CP000031.PE415

CP000031.PE415       Location/Qualifiers
FT   CDS_pept        437751..438938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0424"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93742"
FT                   /db_xref="GOA:Q5LWB8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB8"
FT                   /protein_id="AAV93742.1"
FT                   /translation="MRNSSFLRAYGFWHWGEGLQTVLFTWYMAFHVGLPASQIGFYQAL
FT                   VLSPFLLFTIAGGILTDRIGARRSFRAATVLFGLLLIGYGVLDHVFGFVPVLFFAYCLA
FT                   AGVVSAVSNPAIDTFIPDATPRRAQENALLAANAHNMAKLAGNLTGLTLPLLHAVGGFG
FT                   VNGLLMLASAASLRPVQPATRQGAPEPELSERPSLRRLWAHFRECPENFDILLSSAMLG
FT                   LLVVPVGYILLPLALRANFPGYGDLLAVMTVSSWLGAIAATWAIGRLSRRIGHPGRIAL
FT                   LVWGGYACALVTLPLVPGFAWLCVLVAVLGMVKLGKAMVYGKYIRNCPDTLRGSVIAVE
FT                   QTAFWGLATLGTFLLGWLVDLIGLVPTIHLVALSVGLAALALALRGRLSGLTPAL"
     atgcgcaatt cttcctttct tcgcgcctat gggttctggc attggggcga ggggctgcaa        60
     acggtgttgt tcacctggta catggccttt cacgttggcc tgcccgccag ccagatcggg       120
     ttctatcagg ccctggttct gtcacccttt ctgctgttca ccatcgccgg gggtatcctg       180
     accgaccgta tcggcgcgcg gcgcagtttc cgcgcggcga ccgtgttgtt cggtctgttg       240
     ctgatcgggt atggggtgct ggatcacgtc tttggcttcg tgccggttct gttctttgcc       300
     tattgtctgg cggcgggggt ggttagcgcg gtgtcgaacc cggccatcga cacgttcatc       360
     cccgatgcga ccccgcgccg ggcgcaggag aacgccttgc tggccgccaa tgcccacaac       420
     atggccaagc tggcggggaa cctgaccggg ttgaccttgc ccttgctgca cgcggtgggc       480
     gggttcgggg ttaatggtct gttgatgctg gcaagcgcgg ccagtctgcg cccggttcag       540
     cccgcaaccc ggcagggggc accggaaccg gagctgtccg agaggccctc gcttcgccgc       600
     ctgtgggcgc attttcgaga gtgccccgag aatttcgaca tcctgctgtc gagcgccatg       660
     ctggggctgt tggtggtccc ggtcgggtat atcctgctgc cgctggcgct gcgtgccaat       720
     tttccgggat atggcgacct gctggcggtc atgacggtgt ccagctggct gggtgcgatt       780
     gcggcgacct gggcgattgg ccgactctcc cggcggatcg gccacccggg gcggatcgcg       840
     ctgttggtct ggggcggata tgcttgtgcg ttggtcacgc tgcccctggt accggggttt       900
     gcctggctgt gcgtgctggt cgcggtgctg ggcatggtca agctgggcaa ggcgatggtc       960
     tatggaaaat acatccgcaa ttgccccgac accctgcgcg gatcggtcat tgccgtcgag      1020
     cagacggcat tctgggggct ggcgacgctg ggcacgttcc tgctggggtg gctggtcgat      1080
     ctgatcgggc tggtgccgac aatccacctt gtcgcgctga gtgtcggcct ggctgcgttg      1140
     gccttggccc tgcgggggcg cttgtccggt ctgacgcctg ccctttga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page