(data stored in ACNUC7421 zone)

EMBL: CP000031.PE416

CP000031.PE416       Location/Qualifiers
FT   CDS_pept        complement(438976..440388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0425"
FT                   /product="MORN repeat protein"
FT                   /note="identified by match to protein family HMM PF02493"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93743"
FT                   /db_xref="GOA:Q5LWB7"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB7"
FT                   /protein_id="AAV93743.1"
FT                   /translation="MTRNRRRIAFAAILAMATTAHAQQGQVLTTQDEIGGVYEGTFRGG
FT                   LQHGTGTYRLPNGYEYSGEWVDGEIRGRGVARFPNGSVYEGSFAQGKPEGMGKITFSDG
FT                   GTYEGEWSNGVINGQGVAVYANGVRYEGGFRDARHHGKGVMQSPGGYVYEGDWADGQKE
FT                   GLGKITYPDGAVYEGGIVAGQRHGEGTLTLPDGLVYVGFWADGQINGKGTLTQANGDVY
FT                   EGDLIAGRREGKGKVTYANGDVYQGDFTDDRREGQGIFTGTDGYSYAGSWVAGQIEGQG
FT                   RVTYPDGSVYEGNFRADLADGQGKITYPDGSSYEGEWVAGVIEGTGTAIYANGIVYKGT
FT                   FKNAKNHGQGVMTYADGYRYEGEWQDGVRHGQGKATYPDGSVYTGQYVNGQREGDGEIV
FT                   MADGFRYKGQWQSGKISGIGVATYANGDIYEGHFRNGKRQGEGTMKYASGQEEKGNWDN
FT                   GALTKGAAASDG"
     atgaccagaa accgcagacg catcgcattt gccgccatcc tggccatggc cacgacggcc        60
     catgcccagc agggccaggt cctgaccacg caggacgaga tcggcggcgt ctacgagggc       120
     acgttccggg gcggtctgca acatggcacc ggcacctatc ggctgcccaa tggctatgaa       180
     tacagcggtg aatgggtcga tggcgagatc cgcggccgtg gcgtcgcgcg ctttcccaac       240
     gggtcggtct acgagggcag ctttgcccag ggcaagcccg agggcatggg caagatcacc       300
     ttttccgatg gcggcaccta cgaaggtgaa tggtcaaacg gggtgatcaa cggccagggg       360
     gtcgcggtct atgccaatgg cgtgcgctac gagggcgggt tccgcgatgc ccgccatcac       420
     ggcaagggcg tgatgcaaag cccgggcggc tatgtctatg agggcgactg ggccgatggc       480
     cagaaagagg ggctgggcaa gatcacctat cccgacggcg cggtctacga aggtggcatc       540
     gtcgcgggcc agcgtcatgg cgagggcacg ctgaccctgc ccgacgggct ggtctatgtc       600
     ggtttctggg ccgatggcca gatcaacggc aagggcacgc tgacccaggc caatggcgat       660
     gtctacgaag gcgacctgat cgccggccgg cgcgagggca agggcaaggt cacctatgcc       720
     aatggcgacg tctatcaggg tgatttcacc gatgaccggc gcgagggtca gggcatcttc       780
     accggcaccg acggctacag ctatgccggg tcctgggttg cgggccagat cgagggtcag       840
     ggccgcgtca cctatcccga cggctctgtc tacgagggca acttccgcgc cgatctggcc       900
     gatggccagg gcaagatcac ctatcccgac ggctcaagct atgagggcga atgggtcgcc       960
     ggcgtgatcg agggcacggg gaccgcgatc tatgccaatg gcatcgtcta caagggcacc      1020
     ttcaagaatg ccaagaacca cgggcagggc gtcatgacct atgccgacgg ctatcgctac      1080
     gagggcgaat ggcaggacgg ggtccgccac ggtcagggca aggccaccta tcccgacggc      1140
     tcggtctata ccggtcaata tgtcaacggc cagcgcgagg gcgacggcga gatcgtgatg      1200
     gccgacgggt tccgctacaa gggccagtgg cagtcaggca agatcagcgg catcggagtc      1260
     gccacctatg ccaatggcga tatctacgag ggccatttcc gcaatggcaa acgtcagggc      1320
     gagggcacca tgaaatacgc cagtggccag gaagaaaagg gcaactggga caatggcgcg      1380
     ctgaccaagg gcgcggcagc ctcggacggc tag                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page