(data stored in ACNUC7421 zone)

EMBL: CP000031.PE419

CP000031.PE419       Location/Qualifiers
FT   CDS_pept        443116..444447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0428"
FT                   /product="amino acid deaminase, putative"
FT                   /note="identified by similarity to GB:AAA86752.1; match to
FT                   protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93746"
FT                   /db_xref="GOA:Q5LWB4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB4"
FT                   /protein_id="AAV93746.1"
FT                   /translation="MPGPRPTDFYSDLALPKQVEVVVVGGGIIGVSAALELAERGVSVL
FT                   LCEKGQIGAEQSSRNWGWVRLGMRDPREIPLMQAALEIWDGLDDRLGRSTGFVRSGILF
FT                   AASGRRSVGNLERWARHVDGLETRARMIEGAELAAHLPGHSKLPRAALFMPQDGRAEPQ
FT                   WAAPAVAEGARDRGAQILTACAVRSVDVEAGQVTGVYTERGRVACSRVILAGGAWSRLF
FT                   AGNAGVSLPQLKVLNTVLRSSPTVEGPNAAYWSDGFAMRRRADGGFTIAAGTQNTVDLV
FT                   PDSLRLAHRFLPAFRQEWRSLRFRLSRRWLEEAQQARQWQPGDVTPFELTRILDPEPSQ
FT                   KHLRRAWNAARRAFPMLDGSEIMQSWAGMIDVTPDAIPVISDVPALPGLFIATGFSGHG
FT                   FGIGPGAGRLVADLATGETPVVDPWAFRLSRFSDGSRVAPDPGY"
     atgcccggac ctcgcccgac agatttctat tccgacctcg ccctgcccaa gcaggtcgag        60
     gttgttgtgg ttggcggcgg catcatcggg gtatcggcgg cgctggaact ggccgagcgg       120
     ggcgtttcgg tcctgctgtg cgagaagggc cagatcgggg ccgaacaaag ttcacgcaac       180
     tggggttggg tgcgtctggg catgcgcgat ccgcgcgaga tacccctgat gcaggcggcg       240
     ctggagatct gggacgggct ggatgaccgg cttggacgca gcaccggttt cgtgcgctcg       300
     ggcatcctgt tcgccgcttc ggggcggcgc agcgtgggca acctggaacg ctgggcgcgc       360
     catgtggatg ggttggagac gcgggcacgg atgatcgagg gggcggaact tgccgctcat       420
     ctgcccggtc acagcaagct gccgcgcgcg gcgctgttca tgccacagga tggccgggcc       480
     gagccgcaat gggcggcccc tgcggtcgcc gagggcgccc gcgaccgggg tgcgcaaatc       540
     ctgaccgcct gcgctgtgcg ctcggtggat gtcgaggcgg ggcaggtgac cggcgtctat       600
     accgaacggg gccgggtggc ctgttcccgt gtgatcctgg cgggcggggc gtggtcgcgg       660
     ctgttcgccg ggaatgcggg tgtgtcgctg ccgcagctca aggttctgaa cacggtgctg       720
     cgcagttcac ccacggtcga gggtccgaat gccgcctatt ggtctgacgg gttcgccatg       780
     cgccgtcgtg ccgatggtgg ctttaccata gctgcgggca cgcagaacac ggttgatctg       840
     gtgcccgaca gtctgcggct ggcacatcga ttcctgcccg ctttccggca ggaatggcgg       900
     tcgctgcgct ttcggctgtc gcgccgctgg ctggaagagg cgcagcaggc gcggcaatgg       960
     caaccgggtg atgtgacccc gttcgagctg acccggatac ttgaccccga accctcgcag      1020
     aaacatctgc gccgcgcctg gaatgcggcg cgccgggcct ttccgatgct cgacgggtcc      1080
     gaaatcatgc agagctgggc cgggatgatc gacgtcaccc cggacgcgat cccggtgatc      1140
     tcggatgtgc ccgccctgcc gggcctgttc atcgcaaccg ggttttccgg ccacggcttt      1200
     gggatcgggc cgggcgccgg gcggctggtc gccgatctgg cgacgggcga aaccccggtg      1260
     gtcgacccgt gggcgtttcg cctgtcgcgg ttcagtgacg gcagccgggt ggcgcccgat      1320
     ccgggctatt ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page