(data stored in ACNUC7421 zone)

EMBL: CP000031.PE423

CP000031.PE423       Location/Qualifiers
FT   CDS_pept        447721..448167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0432"
FT                   /product="rrf2 family protein"
FT                   /note="identified by match to protein family HMM PF02082;
FT                   match to protein family HMM TIGR00738"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93750"
FT                   /db_xref="GOA:Q5LWB0"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB0"
FT                   /protein_id="AAV93750.1"
FT                   /translation="MRITKRTNIAVRLLMFCAAHPGRLVTKSEIAEVCNVSENHLAQVI
FT                   NQLSQLGFLTTQRGRNGGMCLGMAADAIRIGEVFRHVEGNLPMVECFADADNSCPLTDA
FT                   CRLRLALRDAAQAFYASLDEITLDALVCDNTDLLKILNPVVCAR"
     atgcgcatta ccaagcgcac aaatattgcg gttcggctgc tgatgttctg cgccgcccat        60
     cccggccggc tggtgaccaa gtccgagatc gccgaggttt gcaacgtctc ggaaaaccat       120
     ctggcgcagg tgatcaacca gctcagtcag ctgggttttc tgaccacgca gcggggccgt       180
     aacggcggca tgtgtctggg tatggcggcg gatgcgatcc ggattggcga agttttccgc       240
     catgtcgagg gcaatctgcc gatggtggaa tgtttcgcgg atgccgataa cagctgcccc       300
     ctgaccgacg cctgccgcct gcggcttgcg ctgcgggatg cggcacaggc cttttacgcc       360
     tcgctggacg agatcactct ggatgcgctg gtctgtgata acacggatct gctcaagatc       420
     ctcaatccgg tggtctgcgc gcgctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page