(data stored in ACNUC7421 zone)

EMBL: CP000031.PE430

CP000031.PE430       Location/Qualifiers
FT   CDS_pept        complement(453771..454187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0439"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93757"
FT                   /db_xref="GOA:Q5LWA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA3"
FT                   /protein_id="AAV93757.1"
FT                   /translation="MPTHNQTQIPSMTRVNHILIPGIVLLVSALLVQISGLTLLLGAHP
FT                   WWAHKVIWMGLPIGIGLALIAGALRVPRRLRQIGFTLLTLVAFLIATEGKTQFTASFAE
FT                   NTAAGRAWYFGWIATCALITATAASLFRYSHQTD"
     ttgccaacgc acaaccaaac ccagataccc agtatgacac gcgtcaatca catcctcatc        60
     ccgggcatcg tattgcttgt ttcggccctt ctggttcaga tcagcgggtt gaccctgtta       120
     cttggcgctc atccctggtg ggcgcacaag gtgatctgga tgggcctgcc gatcggcatt       180
     ggtctggccc tgatcgctgg ggctttgcgc gttccgcgcc ggctgcggca gatcggattc       240
     accctgttga cgctcgtcgc atttctgatc gccacggaag gcaaaaccca gttcaccgcg       300
     tcttttgccg aaaacaccgc cgccggacgc gcctggtatt tcggttggat cgcaacctgt       360
     gccctgatca ccgcaaccgc cgcatcactt ttccgctatt cccaccaaac cgattga          417
//

If you have problems or comments...

PBIL Back to PBIL home page