(data stored in ACNUC7421 zone)

EMBL: CP000031.PE431

CP000031.PE431       Location/Qualifiers
FT   CDS_pept        454284..454676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0440"
FT                   /product="thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93758"
FT                   /db_xref="GOA:Q5LWA2"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA2"
FT                   /protein_id="AAV93758.2"
FT                   /translation="MTDPQPSGELTLRTLAMPRDVNVNGDIFGGWVLSQMDIAAGLTAG
FT                   ARAGGRVTTVAVDAMKFIRPVGVGDVLCIYCQVVRVGRSSMAIEIEAWALRDRQGLREK
FT                   VTEAVFTFVAIDEEGRPRPVDAAAAG"
     atgaccgatc cacagccgag cggggaactg acccttcgca cacttgcgat gccgcgcgat        60
     gtaaacgtca acggcgacat ctttggcggt tgggtgctga gccagatgga tatcgccgcg       120
     ggtcttacag ccggcgcgcg ggccggtgga cgggtgacca cggtggcggt ggatgcgatg       180
     aagttcatcc ggcccgtcgg cgttggcgac gtgttgtgca tctattgcca ggtggtgcgg       240
     gtcgggcgca gctcgatggc gatcgagatc gaggcctggg cgctgcgtga ccgacagggg       300
     ctgcgtgaaa aggtgaccga ggctgtgttc acctttgttg ccatcgacga agaaggtcgg       360
     ccccgcccgg tcgatgccgc cgctgcaggc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page