(data stored in ACNUC9435 zone)

EMBL: CP000031.PE432

CP000031.PE432       Location/Qualifiers
FT   CDS_pept        454811..455152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93759"
FT                   /db_xref="GOA:Q5LWA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA1"
FT                   /protein_id="AAV93759.1"
FT                   /translation="MEIIMQILVGIAGLSLAVLIYAWAYGRAHDPAAPAWARGQLFASV
FT                   ASLVATSLAPIGAGYLTAGLLWPDGLSLVWGLPVAIGAVPVVWVFSLRLLRRGRDRAQS
FT                   PTGLARAMA"
     gtggagatca tcatgcaaat tctggtgggt attgccgggc tttcgctggc ggtgctgatc        60
     tatgcctggg cctatggtcg ggcgcatgac ccggccgcgc cggcctgggc gcgggggcaa       120
     ttgttcgcct cggtggcgtc tttggtggcg acctcgctgg cgccgatcgg ggcgggctat       180
     ctgacagcgg gactcctgtg gcccgacggg ctgagcctcg tctgggggct gccggtggca       240
     atcggtgcgg ttccggtcgt ctgggtgttc tcactgcgcc ttctgcgccg gggccgggac       300
     agggcgcaat cgccgaccgg gcttgcgcgc gcaatggcat ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page