(data stored in ACNUC9435 zone)

EMBL: CP000031.PE434

CP000031.PE434       Location/Qualifiers
FT   CDS_pept        455724..455942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0443"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC62291.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93761"
FT                   /db_xref="GOA:Q5LW99"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW99"
FT                   /protein_id="AAV93761.1"
FT                   /translation="MTGVEWMTLDRAVMMFAGFMVLLSVLLTALVSPLWMWFTVFIGVN
FT                   LIQSSVTGFCPAAMVLKKLGFKTGTAF"
     ttgacaggag ttgaatggat gaccctcgat cgtgccgtga tgatgtttgc cggcttcatg        60
     gtgctgctca gcgtgttgct gacggcgctg gtctcgccct tgtggatgtg gttcaccgtg       120
     ttcatcggtg taaacctgat ccagtcctcg gtcaccggat tttgcccggc ggccatggtt       180
     ttgaagaagc tggggttcaa gaccgggacc gcgttctga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page