(data stored in ACNUC7421 zone)

EMBL: CP000031.PE436

CP000031.PE436       Location/Qualifiers
FT   CDS_pept        456283..456858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ60337.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93763"
FT                   /db_xref="GOA:Q5LW97"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW97"
FT                   /protein_id="AAV93763.1"
FT                   /translation="MSIYVRPRVPGATIFFTVTLANKGSGLLTDQIGLLRTTVWQTRRE
FT                   RPFHIDAWVVLPDHLHAVWTLPRGDTDFSTRWGAIKARFTMGVRKAGFSPPPDLPVVRS
FT                   GRYAGLKPGLRSEKREAGVWQRRFWEHHIRGPDEYLAAVSFCHNDPVKHGLVTDAKAWP
FT                   FSTVHRKMQTSGEMCRAGFSPPSVVGPG"
     atgtcgatct atgtcaggcc cagggtgccc ggcgccacga ttttctttac cgtgacgctg        60
     gccaacaagg ggagcggatt gctcaccgat caaatcggcc tgctgcgcac gacggtttgg       120
     caaacgcgaa gggagcgccc gttccacatc gacgcctggg tggtgctgcc ggatcacctg       180
     catgctgtct ggacgctgcc gcgcggagat acggattttt cgacccgctg gggcgcgatc       240
     aaggcacggt ttaccatggg tgttcgtaag gcgggcttca gcccgccgcc cgatctgcct       300
     gtggtgcggt ctggaagata tgccgggctg aagcccggct tacgttcaga aaaacgtgaa       360
     gccggcgttt ggcagaggcg attctgggag catcacatca gagggccgga cgagtatttg       420
     gcggcagttt cgttctgtca caacgatccg gtaaagcatg gattggtcac ggatgccaag       480
     gcgtggccgt tttccactgt gcatcgcaaa atgcagacct ccggagagat gtgtagggcg       540
     ggcttcagcc cgccttctgt cgttgggccg ggctaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page