(data stored in ACNUC7421 zone)

EMBL: CP000031.PE439

CP000031.PE439       Location/Qualifiers
FT   CDS_pept        459926..460420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0448"
FT                   /product="MOSC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93766"
FT                   /db_xref="GOA:Q5LW94"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW94"
FT                   /protein_id="AAV93766.1"
FT                   /translation="MPPQRRRVMTDLQTLIAGWAQPGRVGWIGLRPERRAALIAVDEGL
FT                   VGLDGLAGDHGRPGKRAVTLVQGEHLGAIGAYLGRGAVSPLDLRRNIVVEGINLSALKG
FT                   RAVRVGGAVLRLSVICAPCSRMEETFGTGGYSAVRGHGGWCAEVLEPGLIKLGDPVRPA
FT                   D"
     gtgccaccgc agcggagaag agtgatgacc gacctgcaaa cactgatcgc gggctgggcg        60
     cagccggggc gggtcggctg gatcgggctc aggcccgagc ggcgcgcggc gctgatcgcg       120
     gttgacgagg gtcttgtcgg gcttgacggt ctggcgggcg atcacgggcg gcccggcaag       180
     cgggcggtaa cgctggtgca gggcgaacat ctgggtgcca tcggcgccta tctggggcgc       240
     ggggcagtgt cgcccttgga tctgcggcgc aacatcgtgg tcgaggggat caacctgtcc       300
     gcgctcaagg gtcgcgcggt gcgggtgggc ggtgcggttc tgcgcctgag cgtgatctgt       360
     gcgccctgtt cgcggatgga agagacattc ggcaccggcg gctattcggc ggtgcgcggg       420
     catggcggct ggtgtgccga agtgctggag ccggggttga tcaagttggg cgatccggtg       480
     cggcctgccg attga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page