(data stored in ACNUC7421 zone)

EMBL: CP000031.PE443

CP000031.PE443       Location/Qualifiers
FT   CDS_pept        complement(463501..463923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AD3572"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93770"
FT                   /db_xref="GOA:Q5LW90"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW90"
FT                   /protein_id="AAV93770.1"
FT                   /translation="MTEQPTHPMTPQDCLVAIMMAVSASDENIRTAELVKIQSAVNMLP
FT                   VFADYDIDRMKRVSQVVFDLFEQEDGLDALFGLVRDNLPERLFETAYALACDVAAADGT
FT                   LAETELRLLEEIRYELNIDRLHAAAIERGARARHVV"
     atgaccgagc aaccgaccca cccgatgacc ccgcaggatt gcctggtcgc gatcatgatg        60
     gcggtctccg cctcggacga aaacatccgc actgccgaac tggtcaagat ccagtcggca       120
     gtgaacatgc tgccggtctt tgccgattac gacatcgacc ggatgaagcg ggtcagtcag       180
     gtggtgttcg acctgtttga acaagaggac gggctcgacg cactctttgg gctggtgcgt       240
     gacaaccttc ccgaacgcct gtttgaaacc gcctatgcgc tggcctgcga tgtggccgcc       300
     gccgacggta ccctggccga gaccgagctg cgtctgctcg aagaaatccg ctacgagctc       360
     aatatcgacc ggttgcatgc cgccgccatc gagcgcggtg cccgcgcccg tcacgtggtc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page