(data stored in ACNUC7421 zone)

EMBL: CP000031.PE449

CP000031.PE449       Location/Qualifiers
FT   CDS_pept        complement(467966..470359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0458"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93777"
FT                   /db_xref="GOA:Q5LW84"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW84"
FT                   /protein_id="AAV93777.1"
FT                   /translation="MILIGPLLHLGIRRQIGNRTPRFPQRPLWHHSIDSARLGPERQGC
FT                   IGIDQPVVRCAGLVHLQPQGVGAARADPMIGVPLIDQIPGPIEIQPRETGVDPLGPVDV
FT                   SIDRAELVAGDCHAIDEMANPMRLDHDIAEPGRHLARQKDIVGDAQRAERESAIEVRVR
FT                   VLFVSPFQAAIVDIVLGKSRARVSPDQYDTRCARPVVNGIALKEVVAQDHMVLPRHDGK
FT                   MTEPGRPAMAQLDVVGIGVEPDAAAVRHVQRLFRREKLAPVDQHALTATTDRGDSTILW
FT                   PTDKTIVKRECSAVRSQPDRAAMGVTLELDVLHVELRQRAEAAEIQHVFEAAEGEDLGA
FT                   CRIIERRVQCDLTGPHVFRAHIDFAPDTRSRHQGTHRNIGDIRHVVQLTRVIGVICRLR
FT                   DKGIGIPSGTRHRHQLPVADHPSGRETGPVWNSRLHVDRRGDRHIAPAHVQRFVIRPVQ
FT                   QRLKRLAKGGFLVTKGRDIGRKIKILGQQQHLVDRHRHRALEIDLRCQADRLPQEISSA
FT                   RHENAAPSGCAIGGLECGRVVGDPIAHRTVITDIDLAQHVTQERAGDIGDLDIVDPHDA
FT                   AIRPFEIEAEMTIERRRPPDHVDTAAIAGSHDARHLDHIAIAGQRGRGPLFRHAADMRT
FT                   ACRTGPPGDPNAGQVATDRLDPDLDLQVTARLQGRLPHIAQLLNRCGLLQFQAAAKIGI
FT                   RRNKGRIRRPIIGIRPRRAVAARPHIQPQLKGGRHEVDAVGDCLVHTNPFPNRATDDLP
FT                   ARFHVTGPGRTRTRQMGRTKGLIPAHSTVTVTLPQTEGGGVSRT"
     ttgatcctga ttggtcccct gctgcacctg ggcataaggc gccaaatagg caaccgcacc        60
     ccccgattcc cgcagcggcc cctgtggcac cacagcatcg actccgcgcg tctcggcccc       120
     gaacggcaag gttgcatcgg tattgatcag ccagttgtcc gatgcgctgg tctggtccac       180
     ctccagccgc agggggttgg cgctgcgcgt gctgacccca tgataggtgt tcccctgata       240
     gatcagatcc cgggtccgat cgaaattcag ccccgagaaa ctggtgtcga cccgctcggc       300
     ccggtcgatg tatccattga tcgagcggaa cttgttgccg gtgactgtca tgccattgat       360
     gaaatggcca accccatgcg gcttgatcac gatatagctg aaccagggcg ccacctcgcc       420
     cgacaaaaag atattgtcgg tgatgctcag cgcgctgaac gagaatccgc cattgaagtc       480
     agggttcggg tcttgttcgt tagtccattc caggctgcaa ttgtcgacat agttctcggc       540
     aaaagtcgcg ctcgagtaag tcccgatcag tacgataccc gctgtgcgcg gcccgttgtc       600
     aacggcatcg ccctgaaaga agtggttgcc caggatcata tggttctgcc ccgccatgac       660
     ggcaaaatga cggaaccggg tcgcccggca atggcgcagc ttgacgtcgt tggcattggt       720
     gttgaacccg atgctgctgc ggtccggcac gttcagcgcc tcttccgacg agagaaactg       780
     gcacccgtcg atcagcatgc cctgacagcc accaccgatc gaggtgattc cacgatcctt       840
     tggccgactg ataaaacaat cgtaaagcgc gaatgtagcg ccgtacggag ccagccggat       900
     cgcgctgcaa tgggtgttac actggaactc gatgttctgc atgttgaact tcgacagcga       960
     gctgaagccg ctgaaatcca gcatgtattt gaagctgcgg aaggtgaaga cctgggtgcc      1020
     tgccgcatca tagagcggcg cgttcagtgt gatctcaccg gcccccacgt ttttcgagcg      1080
     cacatagatt tcgcgcccga cacccgctcc cgtcaccaag gaacccaccg gaatattggc      1140
     gatattcgtc acgttgttca gcttacgcgc gtcattgggg tcatatgtcg cctgcgagat      1200
     aaaggtatcg gtatcccaag cgggacccgc caccgccacc agctgcccgt tgcggatcac      1260
     ccgtcgggtc gagaaactgg tccggtttgg aacagccgcc tgcatgtcga tcggcgcggt      1320
     gaccgacaca ttgcgcccgc ccatgtccag cgattcgtga tccgacccgt tcagcagcgc      1380
     ctgaaacgcc ttgcgaaagg cggtttcctc gtcaccaaag gccgcgatat aggtcggaag      1440
     atcaaaattc ttggtcaaca gcagcatctt gtcgacaggc atcgtcaccg tgccctcgaa      1500
     atcgatctcc gatgccaggc tgaccgtctg ccccaggaaa taagttccgc ccggcacgaa      1560
     aacgcggcgc cctccggctg cgctatcggc ggcctcgaat gcggccgagt cgtcggtgac      1620
     cccatcgccc accgcaccgt aatcacggac atcgacctgg ctcagcatgt cacgcaggaa      1680
     cgcgccggtg atatcggtga tctcgatatc gtcgatccgc acgatgccgc cattcgaccc      1740
     ttcgagatcg aggccgaaat gaccatagag cgccgacgcc ccccagacca tgtcgacacc      1800
     gccgcgattg ccggatccca cgatgcccgt cacctcgacc acatcgccat agctggtcag      1860
     cgtggtcgag ggcccctgtt ccgtcacgcc gccgacatgc gcaccgcctg ccgcaccggc      1920
     ccacccggcg acccgaacgc tgggcaggtt gccactgatc gccttgatcc ggaccttgat      1980
     ctgcaggtaa cagcccggct gcaagggcgt ctgccccata tagcgcagct tctgaaccga      2040
     tgcggtcttc tgcaattcca ggcagccgcc aaaatcggca tccgccggaa caaaggccgc      2100
     attcggcgcc ccatcatagg tatccgaccc cggcgtgccg tcgccgctcg accacacatt      2160
     cagccccagc tgaaaggcgg gcggcatgaa gttgatgccg tcggtgattg ccttgttcat      2220
     acaaatccct ttcccaatcg cgccactgac gacctgccag cgcgctttca tgtgacgggt      2280
     ccgggccgca cccgaacgcg ccaaatgggt agaacaaagg gattaatccc ggctcatagc      2340
     accgtgacgg tgacgttgcc tcaaaccgag gggggcggtg tctccagaac ttga            2394
//

If you have problems or comments...

PBIL Back to PBIL home page