(data stored in ACNUC7421 zone)

EMBL: CP000031.PE45

CP000031.PE45        Location/Qualifiers
FT   CDS_pept        46922..47899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0046"
FT                   /product="thiamine biosynthesis oxidoreductase ThiO,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93377"
FT                   /db_xref="GOA:Q5LWJ3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ3"
FT                   /protein_id="AAV93377.1"
FT                   /translation="MTLWSVIGAGVAGLTVATEMVARGARVQVFDPGGPPGPHGCSWWA
FT                   GGMLAPWCEYENAEEPVLRLGQQAIGWWEQHTTVTRRGTLVVANPRDLPDLRRFGRRTE
FT                   GFREINQTEILGLESDLGAFSKGLHFPDEAHLDPRRALSDLYRGLLDKDVDFHRKPAPA
FT                   GLENAIDCRGLHAREVLHDLRGVKGEMLVIRAPDVALTRPVRLLHPRMPLYVVPRADHV
FT                   YMLGATMIESEDSGRITARSMLELLSAAYALNPAFGEAEVLEIGVDLRPAFPDNLPRIR
FT                   RLGRTIYANGLYRHGYLLAPALAQGVADLALNNTHTELVDEDRA"
     atgacgctgt ggtcggtcat cggggccggt gtggccggat tgaccgtcgc gaccgagatg        60
     gtcgcgcgcg gtgccagagt gcaggtgttc gatccgggtg gcccaccggg cccgcatggc       120
     tgcagctggt gggcgggcgg catgctggcg ccatggtgcg agtacgagaa tgccgaggaa       180
     ccggtcttgc gcctgggcca gcaagccatc ggctggtggg agcaacatac caccgtcacg       240
     cgtcgcggca cacttgtggt ggccaatccg cgcgatctgc ccgatctgcg ccggttcggt       300
     cgccggacag aagggtttcg cgaaatcaat cagacggaaa tccttggctt agagtctgat       360
     ctcggtgcgt tctccaaagg gcttcatttc ccggacgagg cgcatctgga tccccgccgc       420
     gcactctctg atctttatcg cggtttgctc gacaaggatg tggatttcca ccgaaaaccc       480
     gcccccgccg ggttggaaaa tgccatcgat tgccgcgggc tgcatgcgcg cgaggtgctg       540
     cacgacctgc gcggcgtcaa aggggagatg ctggtcattc gcgccccgga tgtggctctg       600
     acacgcccgg tccgattgct tcatccccgc atgccgcttt atgtcgtgcc ccgcgctgac       660
     catgtctaca tgctcggcgc aactatgatc gagagtgagg acagcggccg catcacagcg       720
     cgctccatgc tggagctgct cagcgccgcc tatgccctga accccgcctt tggcgaggcc       780
     gaggtgctgg agatcggcgt cgatctgcgc ccggcctttc ccgacaacct gccgcgcatc       840
     cggcggttgg ggcggaccat ttatgccaat ggcctttatc gccacggcta cctgctggcg       900
     cccgcgctgg cgcaaggggt ggccgacctg gcgctcaata acacgcatac ggagttggtc       960
     gatgaagatc gtgcttaa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page