(data stored in ACNUC7421 zone)

EMBL: CP000031.PE452

CP000031.PE452       Location/Qualifiers
FT   CDS_pept        471280..471909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0461"
FT                   /product="ParA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93779"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW81"
FT                   /protein_id="AAV93779.1"
FT                   /translation="MGHVITVAQQKGGSGKTTLAVNLAVAFMRAGRRVALMDTDPQGSA
FT                   GRWFMARLEAGGDPGLEFSTASAWGVSYEVRKLAKDHDIVIIDTPPKADSDLRPALREA
FT                   DLVLIPVATSHLDLWAVEMVLYLAEREDKPALMVMTRNRPGTRLAQDVAAKAQELNAEL
FT                   AQAALANRVTYAETLGHGRAALEAPKGPAHAEVTGLMREIEIALGL"
     atgggacatg tcatcacggt cgcacagcag aagggcgggt cgggcaagac cacgctggcg        60
     gtgaacctgg ccgttgcctt catgcgcgcg ggcaggcgcg tggcgctgat ggataccgat       120
     ccgcaggggt cggcgggtcg ctggttcatg gcgcggctcg aggcgggtgg cgatccgggg       180
     ctggaattct cgaccgcttc ggcctggggt gtcagctacg aggtgcgcaa actggccaag       240
     gaccatgaca tcgtcatcat cgacaccccg cccaaggccg acagcgacct gcgcccggcc       300
     ctgcgcgagg ccgatctggt gctgatcccg gtggcgacct cgcatctgga tctctgggcg       360
     gtggaaatgg tgctttatct ggccgagcgt gaggacaagc cggccctgat ggtgatgacc       420
     cgcaaccgcc ccggtacccg gctggcgcag gatgtggcgg ccaaggcgca agagttgaac       480
     gccgagctgg cgcaagcggc gctggcaaac cgtgtgacct atgccgaaac gctgggccac       540
     ggccgcgctg cgctggaggc gcccaaaggg cccgctcatg ccgaagtaac tggtttgatg       600
     cgggaaatcg aaatcgcgct ggggttatga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page