(data stored in ACNUC7421 zone)

EMBL: CP000031.PE453

CP000031.PE453       Location/Qualifiers
FT   CDS_pept        471959..472285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0462"
FT                   /product="antibiotic biosynthesis monooxygenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93780"
FT                   /db_xref="GOA:Q5LW80"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW80"
FT                   /protein_id="AAV93780.1"
FT                   /translation="MPKIAKAAPVQTVITTFEMTPGTCQDLLEALTEAYADFISKQPGF
FT                   VAAGLHVNDAQTRIANYSQWQRREDFLAMLRTPEMRERNRRINEMCKSFEPVMYEVAET
FT                   FDGN"
     atgcccaaga tcgccaaagc cgcaccggta cagaccgtca tcacgacctt tgaaatgacg        60
     cccggcacct gtcaggacct gctcgaggcg ctgaccgagg cctatgccga tttcatctcg       120
     aaacaacccg ggtttgtcgc cgccggcctg catgtgaacg atgctcagac ccgcatcgcc       180
     aactactcgc aatggcagcg gcgcgaggac ttcctggcca tgcttcgaac cccggaaatg       240
     cgcgagcgca atcggcgcat caacgagatg tgcaagagtt tcgaaccggt gatgtatgag       300
     gtggccgaaa ccttcgacgg caactga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page