(data stored in ACNUC7421 zone)

EMBL: CP000031.PE455

CP000031.PE455       Location/Qualifiers
FT   CDS_pept        472839..473417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0464"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93782"
FT                   /db_xref="GOA:Q5LW78"
FT                   /db_xref="InterPro:IPR021869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW78"
FT                   /protein_id="AAV93782.1"
FT                   /translation="MVVSLVLLAGSLLLLGWSLLTFGSILTPALLVAALGVVVGVVLVL
FT                   RFRLRAAPVWIVIDGSNVLYWRDETPNLHTVRQCVEGLVRNGWTPLLWFDANVGYLVGS
FT                   QYMGPHELSRALRYPASHINVAPKGTPADPLLIEQAGDLGARIVTNDRFRDWVETYPQV
FT                   ADAGLFLRGSASDQGVSLRFAEEPARKRA"
     atggttgttt ctctcgttct tcttgccggc tcgctgcttt tgcttgggtg gtccttgctg        60
     accttcgggt cgatcctgac accagccctg ttggtggcgg cgctgggcgt ggtcgtcggg       120
     gtcgtcctgg tgctgcgctt cagattgcgc gcggcgccgg tctggatcgt gatcgacgga       180
     tcgaacgtgc tctattggcg cgacgagaca cccaacctgc acacggtacg ccaatgtgtc       240
     gaagggttgg tgcgcaatgg ctggaccccg cttttgtggt tcgatgccaa tgttggctat       300
     ctggtcggct cgcaatacat gggcccgcac gagttgtcgc gcgcgctgcg ctatccggca       360
     tcccatatca atgtggcacc caagggcact ccggcggatc ctctgctgat cgagcaggcc       420
     ggtgatctgg gcgcacggat cgtcaccaat gaccgctttc gcgattgggt cgagacctat       480
     ccgcaggtcg ctgatgcggg tctgttcctg cgcggcagcg cctcggatca gggcgtgtcg       540
     ctccgtttcg ccgaggagcc ggcgcgcaag cgggcctag                              579
//

If you have problems or comments...

PBIL Back to PBIL home page