(data stored in ACNUC7421 zone)

EMBL: CP000031.PE456

CP000031.PE456       Location/Qualifiers
FT   CDS_pept        complement(473414..473896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0465"
FT                   /product="pyridoxamine 5'-phosphate oxidase family protein"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93783"
FT                   /db_xref="GOA:Q5LW77"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR014419"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW77"
FT                   /protein_id="AAV93783.1"
FT                   /translation="MTDPYLPADAKTRAQARALIDSARHGALAVLQPGGLAPSVSRISL
FT                   ATDAQGMPVSLVSSLAAHTAALEATPACALLIGEPGAKGDPLTHPRLTLHCSAQLIPRG
FT                   TPEHDALRARYLMLRPKAGLYADFGDFRFVRFAVADGLLNAGFGKAVRLSAEDLST"
     atgaccgacc cctatctgcc cgccgatgcc aaaacccgcg cccaggcccg cgccctgatc        60
     gactccgcac gacatggcgc gctggcggtg ctgcaaccgg gcggccttgc cccctcggtc       120
     agccgcatct cgctggccac cgatgcgcag ggcatgcccg tctcgctggt ctcatccctt       180
     gccgcccata ccgccgccct ggaggcgacc cccgcctgcg ccctgctgat cggagagccc       240
     ggcgcgaagg gcgatccgct gacccatccg cgcctgaccc tgcattgttc cgcgcaactg       300
     atccctcgcg gcacgcccga acatgacgcc ctgcgcgccc gctacctgat gctgcggccc       360
     aaggccgggc tttatgccga tttcggcgat ttccgctttg tccgttttgc cgttgccgat       420
     ggcctgctga acgccggttt cggcaaggcg gtgcggttga gtgccgagga tctttcgacc       480
     tag                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page