(data stored in ACNUC7421 zone)

EMBL: CP000031.PE466

CP000031.PE466       Location/Qualifiers
FT   CDS_pept        complement(480732..481415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAN29788.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93793"
FT                   /db_xref="GOA:Q5LW67"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW67"
FT                   /protein_id="AAV93793.1"
FT                   /translation="MTFLRYAIYFLPPASEAWAGFGASWLGWDVETGQELAHPAETGLD
FT                   VAALTATPRKYGLHATMKPPFRLAEGQDVDALRRACATLAASRPAVTLDGLEIARLGRF
FT                   LALRPVGELGALNALAAACVTELDPFRAPATPQELVRRRAARLSPEQDAHLLSWGYPYV
FT                   LDQFRFHITLTGRLDDDMLMQAQTLLQRRLGPLLPVPFTLADLALVGEAGDGRFHLIHR
FT                   YALSR"
     gtgactttct tgcgatacgc gatctatttc ctgccccccg catccgaagc ctgggcaggg        60
     ttcggcgcat cctggctggg ctgggatgtc gaaaccgggc aagagctggc gcatcctgcc       120
     gaaaccggtc tggacgttgc cgcgctgacc gcgacaccgc gcaaatatgg gctgcacgcc       180
     actatgaaac cgccctttcg tctggccgag gggcaggacg tcgatgcgct gcgccgggct       240
     tgcgcaacac tggcggccag ccgtccggcg gtgacgctgg acgggttgga aatcgcccgg       300
     ctgggccggt tcctggcgct gcgcccggtg ggggagcttg gcgcgctgaa cgcgctggcg       360
     gcggcctgcg tgaccgagct ggacccgttt cgcgcgcctg ccacgccgca agagctggtg       420
     cgccgtcgcg ccgcaaggct gagcccggag caggacgcgc atctgctcag ctggggttac       480
     ccctatgtgc tcgaccagtt ccgctttcac atcaccctga ccggccggct ggacgatgac       540
     atgctgatgc aggcgcagac gctgttgcaa cggcgcctcg gaccgttgct gccggtgccc       600
     ttcacactcg ctgatctggc cctggtggga gaggccgggg atggccggtt tcacctgatc       660
     catcgctacg cgctttcccg ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page