(data stored in ACNUC9435 zone)

EMBL: CP000031.PE468

CP000031.PE468       Location/Qualifiers
FT   CDS_pept        complement(482616..483182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0477"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93795"
FT                   /db_xref="GOA:Q5LW65"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW65"
FT                   /protein_id="AAV93795.1"
FT                   /translation="MRPHGKWGTPNRAQDPEKQIFNATLSVSYPKSPVLPTARHGAAIF
FT                   AGQLCPMTELQAIREALYPEAPRKQTRRLRRADRTRAKALSPLRVLLLLASLPVIAGST
FT                   AIGVYMRTSPYPPELALRHLAALAGCETAALAGLPQARRGEPGYHQRNDADLDGVACGT
FT                   TLADAGMEARTPTQRAPGQAKFVRP"
     ttgcgaccac atggtaaatg gggaaccccg aaccgggcac aagatccgga gaaacaaata        60
     tttaacgcca cattatcagt tagttatcca aaatcccctg tcctgccaac tgcccgccat       120
     ggcgccgcca tattcgcggg gcagctttgc cccatgaccg agctgcaagc gatacgagag       180
     gcgctctatc ccgaggcgcc aaggaaacag acccggcgtc tgcgccgggc cgatcgcacc       240
     cgcgcaaagg cgctgtcgcc cctgcgtgtc ctgctgctgc tggccagtct gccggtgatc       300
     gcggggtcga ccgccatagg tgtctatatg cgcaccagcc cctatccgcc cgagctggcg       360
     ctgcgccatc tggcggcgct ggcggggtgc gagaccgccg ctttggcggg ccttccgcag       420
     gcccggcgcg gcgagcccgg gtatcatcag cgcaacgatg ccgatctgga tggtgtcgcc       480
     tgcggcacca cgctggccga tgccggcatg gaggcgagaa cgcccaccca gcgcgcaccc       540
     gggcaggcga agttcgtgcg gccctga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page