(data stored in ACNUC7421 zone)

EMBL: CP000031.PE469

CP000031.PE469       Location/Qualifiers
FT   CDS_pept        483205..483456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0478"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93796"
FT                   /db_xref="GOA:Q5LW64"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW64"
FT                   /protein_id="AAV93796.1"
FT                   /translation="MRSLLFAATLFAAATPVLADEVTGIILAYDRVDGRIVLEDKTVWS
FT                   LEFVEEIPEGLAVGDEVRIVFEAAGEDGITKINAIHQE"
     atgcgcagcc ttctgtttgc tgcaaccctg ttcgcagccg ccacccccgt actggcagac        60
     gaggtgaccg gtattatcct ggcctatgac cgggtcgacg gtcggatcgt tctcgaggac       120
     aagacggtct ggtcgctgga atttgtcgag gagattcccg aaggtctggc cgtcggcgac       180
     gaggtccgga tcgtcttcga ggccgcaggc gaggacggta tcaccaagat caacgccatt       240
     catcaggaat ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page