(data stored in ACNUC9435 zone)

EMBL: CP000031.PE472

CP000031.PE472       Location/Qualifiers
FT   CDS_pept        complement(485983..486294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0482"
FT                   /product="NADH-ubiquinone oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93799"
FT                   /db_xref="GOA:Q5LW61"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW61"
FT                   /protein_id="AAV93799.1"
FT                   /translation="MRARIYQPARNAMTSGMAKTRKWVLEYAPGSAREVDPLMGWTSSS
FT                   DTQSQVRLRFDSKEEALDYARAHGIDAVVTEPHKRKPNLRARGYGENFATDRRGPWTH"
     atgcgcgcac ggatctacca gcccgcacgg aatgcgatga cctcgggcat ggccaagacc        60
     cgcaaatggg ttctggaata cgcccccgga tcggcacgcg aggtcgatcc gctgatgggc       120
     tggacctcgt ccagcgacac ccagagccag gtccggctgc gctttgacag caaggaagag       180
     gcgctggatt acgccagggc gcacgggatc gacgccgtgg tcaccgaacc gcacaagcgc       240
     aagcccaacc tgcgcgcgcg cggctatggc gagaatttcg ccaccgaccg gcgcggtccc       300
     tggacccact ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page