(data stored in ACNUC7421 zone)

EMBL: CP000031.PE473

CP000031.PE473       Location/Qualifiers
FT   CDS_pept        complement(486480..487127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0483"
FT                   /product="microcystin dependent protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93800"
FT                   /db_xref="GOA:Q5LW60"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW60"
FT                   /protein_id="AAV93800.1"
FT                   /translation="MSKNAFTTFATAAALSLSLIAPASQARAGTDPFVGELMLAGFNFC
FT                   PRGWAEANGALLAISSNTTLFSLLGTMYGGDGRTTFALPDLRGRVAIGVGTGPGLQPIT
FT                   QGERLGQPTTTQTIATMAPHTHLATSNASTSIHVSSDDANIQDPGNAFLGTTSTPTYTT
FT                   TQPDEALANGSATTGVTTTILSTGQGLPQENHQPSLGLKYCIALFGVYPSRN"
     atgtcgaaga acgcatttac cacattcgcg accgccgcgg ccctttcatt gagcctgatc        60
     gcgcccgcgt cgcaagcccg cgccggaacc gatccgtttg tcggcgagtt gatgcttgcg       120
     ggtttcaatt tctgtccgcg cggctgggcc gaggcgaacg gggcgctgct ggccatttcg       180
     tccaatacta cgctgttctc gttgctgggc accatgtatg gtggtgacgg acgcaccaca       240
     ttcgcgctgc ccgatctgcg cgggcgcgtc gccatcggtg tcggcaccgg ccccggcttg       300
     cagcccatca cacagggtga aagacttggc cagcccacca ccacccagac catcgcgacg       360
     atggcgccgc acacccacct ggccaccagc aatgcatcga cctcgatcca tgtgagcagt       420
     gacgatgcca acatacagga tcccggcaac gcgttcctgg gcacgacgtc caccccgacc       480
     tataccacga cgcaacccga cgaagccctg gcaaacggat ccgcgacaac cggtgtcacc       540
     actacgattc tgagcaccgg tcagggcctt ccgcaggaaa accaccaacc gtcgctgggc       600
     ctgaaatact gcatcgcatt gttcggcgtc tacccgtcgc ggaactga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page