(data stored in ACNUC7421 zone)

EMBL: CP000031.PE482

CP000031.PE482       Location/Qualifiers
FT   CDS_pept        495167..495532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0491a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG018;
FT                   similar gene identified in less than 5 other Roseobacter
FT                   strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0491a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86008"
FT                   /db_xref="GOA:V5UYV7"
FT                   /db_xref="UniProtKB/TrEMBL:V5UYV7"
FT                   /protein_id="AHB86008.1"
FT                   /translation="MYDHTAILLSEAEQVVFTTHARIAPTLTELVIIVVFAPIALVIWL
FT                   FIHRSFRSTVYMITTKRVLVIEKQGIVDQIPIQDIQRVTGRRRSMMIYGSDTRLWLARL
FT                   QDGWQFETILERVRKLI"
     ttgtatgatc acacagccat tctgcttagc gaagcggagc aggtggtttt caccacacac        60
     gccaggattg cgccgaccct gacagaactc gtgattatcg tcgtctttgc gcccatagca       120
     ctggtgatct ggctttttat ccatcgtagc tttcgctcga ccgtatacat gatcaccacg       180
     aagcgtgttc tggtgatcga aaagcaaggc attgttgatc agatacccat tcaagacatc       240
     cagcgcgtca ccgggcgtcg gcgttcgatg atgatatacg gttctgacac tcggctgtgg       300
     ttggcccggc tacaggatgg ctggcaattc gagacaatcc tggagcgggt tcggaaattg       360
     atctag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page