(data stored in ACNUC7421 zone)

EMBL: CP000031.PE483

CP000031.PE483       Location/Qualifiers
FT   CDS_pept        495649..496491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0492"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="identified by similarity to GB:BAC74954.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93809"
FT                   /db_xref="GOA:Q5LW51"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW51"
FT                   /protein_id="AAV93809.1"
FT                   /translation="MVDVPRRVTAARIRSLSPGCASPLPETCRRAIAGGGRPVCPPGPE
FT                   HAGMELDFIIEGWAGHLSYLLLVLSMLMRHMLWLRLFVIASAMAGIAFDHFWLQNPVGV
FT                   FWQSLLVLVNVAELALLWRNDRRARFTVEEDRFRETLLSGLSPGRCRRLLDLGRWETLS
FT                   TGTVLTREGQRPEFLTYMASGAVRIERQGRLLRLVGEGHFIGEMSMMGDGLAVATAVMQ
FT                   DSGRVWRIERVKLDRLRESSPAAMAAIETGVARDMRAKLAYQNTGPDTAAQPADGPAD"
     gtggtggatg tacccaggcg cgtgaccgca gcgcggatac gctctctatc gccgggctgc        60
     gcgtcgccct tgcccgaaac atgccggagg gctatcgctg gaggtggcag gcccgtgtgc       120
     ccgccaggtc cggagcacgc tggcatggaa ctggatttca tcatcgaagg ctgggcgggg       180
     catttgtcct atttgctgct cgtgctgtcg atgttgatgc gccacatgct gtggctgcgg       240
     ctgttcgtga tcgcttcggc gatggcgggc attgcgttcg atcatttctg gttacaaaac       300
     ccggtcggcg tgttctggca gagccttctg gtgctggtga atgtcgccga actggcgctg       360
     ctctggcgca acgaccggcg cgcgcggttc acggttgagg aggatcggtt tcgcgagacc       420
     ctgctcagcg gcctgtcccc ggggcgttgc cggcgtttgc tggatctggg ccggtgggag       480
     acgctgtcga ccggtacggt gctgacacgc gaggggcagc ggcccgagtt cctgacctat       540
     atggcctccg gcgcggttcg gatcgaacgg cagggccggc tgctgcgact ggtgggcgag       600
     ggccatttca tcggcgagat gtccatgatg ggggatggac ttgcggtggc gacggcggtg       660
     atgcaggaca gcgggcgggt ctggcggatc gagcgggtca agctcgaccg gctgcgcgag       720
     agcagcccgg ccgccatggc cgcgatcgag accggcgttg cccgcgacat gcgggccaag       780
     ctggcctatc agaacaccgg tccggacacc gccgctcagc cggcagacgg acctgccgac       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page