(data stored in ACNUC7421 zone)

EMBL: CP000031.PE496

CP000031.PE496       Location/Qualifiers
FT   CDS_pept        501740..502174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0504a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG009;
FT                   not identified in other Roseobacter strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0504a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86009"
FT                   /db_xref="UniProtKB/TrEMBL:V5V0I8"
FT                   /protein_id="AHB86009.1"
FT                   /translation="MALMGCKTTVDRETNAASETSPGSTVMYFDPFHGYQIVFFETPET
FT                   SWLWYPGNRTSLPALVRYKGSDVCFKYGSHTFNPVIGKQGGSWDCTPRFILDGLAVASG
FT                   EGDIFGLSDGTVPYRRRKCDGTDGFARINVDPGLYKQGCG"
     atggcgctaa tgggttgcaa gaccacagtt gatcgcgaaa caaacgctgc atccgagacc        60
     tcaccgggaa gtacagtaat gtacttcgat ccgttccatg ggtatcagat cgtctttttc       120
     gaaacgccgg aaacaagctg gctttggtat ccggggaacc gaaccagttt gccggcgctt       180
     gtccggtaca agggaagtga cgtttgcttt aagtatggaa gtcatacctt taatcctgtg       240
     atcggaaagc agggtggcag ctgggactgt acgccccgtt tcatacttga cgggcttgcc       300
     gtagcatctg gcgaaggcga catctttggt ttgtccgatg ggaccgtccc gtaccggcgc       360
     cgaaaatgcg atggaaccga tgggttcgcc aggatcaatg ttgatcctgg cctctacaag       420
     caagggtgtg gttag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page