(data stored in ACNUC7421 zone)

EMBL: CP000031.PE50

CP000031.PE50        Location/Qualifiers
FT   CDS_pept        50309..51349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0050"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="Assignment based partly on membership in ABC
FT                   transporter gene cluster."
FT                   /db_xref="EnsemblGenomes-Gn:SPO0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93381"
FT                   /db_xref="GOA:Q5LWK7"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK7"
FT                   /protein_id="AAV93381.1"
FT                   /translation="MPPASGPGALRNSCNRFGRARSFSLRPPHHERKRDMKHLVTALAL
FT                   LAATPALAQDKMTLLLDWFINPDHGPIIVAQEKGYFAERGLEVEIVAPADPSAPPRLVA
FT                   AGQADLAVSYQPQLHLQIHEGLPLKRVGTLVATPLNCLLVLDNGPIKSPADLKGKKIGF
FT                   SVAGVEEAILTTVLGKYDVALSDVEMINVNFSLSPALMSGQVDAVIGAYRNFELNQMDI
FT                   EGEPGRCFYIEEEGVPSYDELIYVANPDRMDAGKIARFLEATEKATQFIVNNPQASWEI
FT                   FSATSPELQDELNKRAWADTLPRFALRPAGFDAGRYARFETFLKDSGMIDSVNSVSAIT
FT                   IDVTAE"
     gtgccaccgg cctcagggcc tggcgctctg cggaacagtt gcaaccgatt tggccgggcg        60
     agatcgttct cgttgcggcc gccacatcat gaaaggaaac gcgacatgaa acacctggta       120
     accgcattgg cgctgctggc cgccacgccc gccctggcgc aggacaagat gaccctgctg       180
     ctcgattggt tcatcaaccc tgaccacggc ccgatcatcg tggcgcagga aaagggatac       240
     ttcgccgaac gcgggctgga ggtcgagatc gtggcccccg ccgacccctc ggccccgccg       300
     cgtctggtcg ctgccggtca ggccgatctg gcggtcagct atcagccgca actgcacctg       360
     caaatccacg aggggctgcc cctgaaacgt gtcggcacgc tggtcgccac ccccctcaac       420
     tgcctgctgg tactggacaa cggcccgatc aaatcgcccg ccgacctcaa gggcaagaag       480
     atcggcttct ctgttgcagg cgtcgaagag gcgatcctga ccacggttct gggtaaatac       540
     gatgtcgcgc tcagcgatgt cgagatgatc aacgtgaact tctcgctctc gcccgcgctg       600
     atgagcggac aggtcgatgc ggtgatcggc gcctatcgca atttcgagtt gaatcagatg       660
     gatatcgagg gcgagccggg tcgctgtttc tatatcgagg aagaaggcgt gccgtcttat       720
     gacgagctga tctatgtcgc caaccccgac cggatggatg ccggcaagat cgcgcgcttc       780
     cttgaggcca ccgaaaaggc gacgcagttc atcgtcaaca acccgcaagc aagctgggaa       840
     atcttctcgg cgacttcgcc cgaattgcag gacgaactga acaagcgcgc ctgggccgat       900
     acgctgccgc gctttgcgct gcgtcctgct gggttcgacg cgggccgcta tgcccggttc       960
     gagacgtttc tgaaggacag cgggatgatc gacagcgtga actcagtctc ggccatcacc      1020
     atcgacgtga ccgccgaatg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page