(data stored in ACNUC7421 zone)

EMBL: CP000031.PE500

CP000031.PE500       Location/Qualifiers
FT   CDS_pept        505599..506672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AB2876"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93825"
FT                   /db_xref="GOA:Q5LW35"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR016986"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW35"
FT                   /protein_id="AAV93825.1"
FT                   /translation="MKRILIGLAILAGLLAGLALAATLLATGKRPVPDQLAGYHETTLS
FT                   VGHRDVPVSLHIWYPAAQDGTAELVGQNALFYGQYVLRDAKPAPGAHPVVVFSHGSGGN
FT                   ANNHGWLATELARQGMIVVAPNHPGTMSRDSDPHRTPHIWERARDLHAILDSLETNPPL
FT                   GMQPDMDRVASAGFSLGGFSALSIAGVRVSKAAFIDYCDRHAGEFDCGWMQAASVDFAA
FT                   IDPAAYEADYRDPRIKATVSIDPALPQAMTGDSLTAATLPILLVSLGQGEEVPPATRVD
FT                   AMARQMPQARLVETPGAWHFSFLSECSTLGWIIIGLMGEENICSDIGMRDRGVLHEELK
FT                   AVISTFLSENLALSPSG"
     atgaaacgca ttctgatcgg actggcgatt ctggccgggc ttctggccgg acttgcgctt        60
     gccgccactt tgctggccac cggcaagcgc ccggtccccg accagttggc gggttatcac       120
     gaaaccaccc tgtcagtcgg gcatcgcgat gtccccgtat cgctgcatat ctggtatcct       180
     gctgcgcagg acggtactgc cgaactggtg gggcagaacg ccctgttcta cggacagtat       240
     gtcctccggg atgcaaagcc ggcgcctggc gcgcatccgg tggtcgtgtt ttcgcacggc       300
     tccgggggca acgccaataa tcacggctgg ctggcgacgg aactcgcgcg tcaggggatg       360
     atcgtggtgg cgcccaacca tcccggcacg atgtcgcgcg acagcgatcc gcaccgcaca       420
     ccgcatatct gggagcgagc gcgtgacctg cacgccattc ttgacagttt ggaaaccaat       480
     cccccgctcg ggatgcagcc cgacatggac cgggtcgcct cggccgggtt ctcgctgggg       540
     ggcttctcgg cgctcagcat tgcaggggtc cgggtgtcca aggcggcgtt tatcgactat       600
     tgcgaccgcc acgccggaga gtttgattgc ggctggatgc aggccgcgag tgtcgatttt       660
     gccgccattg atccggccgc ttacgaggcc gattatcgcg acccgaggat caaggccacg       720
     gtttcgatcg acccggcatt gccgcaggcg atgacgggcg acagcctgac cgcggccacc       780
     ctgccgatcc tactggtctc gctggggcag ggcgaagagg ttccccccgc gacccgcgtc       840
     gatgcgatgg cgcgccagat gccgcaagca cgccttgtgg aaacgccagg cgcctggcat       900
     ttcagcttcc tctccgaatg cagtaccctg ggctggatca tcatcggact gatgggcgaa       960
     gagaacatct gttcggatat cggcatgcgc gatcgaggcg tcctgcacga agagctgaag      1020
     gcagtgattt cgaccttcct gagcgaaaat ctggctttgt ctccatccgg ttga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page