(data stored in ACNUC9435 zone)

EMBL: CP000031.PE51

CP000031.PE51        Location/Qualifiers
FT   CDS_pept        51382..52026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0051"
FT                   /product="TENA/THI-4 family protein"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93382"
FT                   /db_xref="GOA:Q5LWK6"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK6"
FT                   /protein_id="AAV93382.1"
FT                   /translation="MRAAAGQPWRDYTRHAFVEGMKDGSLARDAFVHYLRQDYVFLIHF
FT                   ARAWALAVVKGETHAEMLAAVGTVNTLVVEEMQLHVGVCEAAGISKDALFATPERPENL
FT                   AYTRFVLEAGYSGDLADLLAALAPCVMGYGEIGARLATEATSEAYKDWIDTYAGPEYQA
FT                   ACKAVGELMDQALTRRIGADFEASPRWERLCRTFRTATELEVGFWQMGLTP"
     atgcgcgcgg cggcgggcca gccgtggcgg gattataccc gccacgcctt tgtcgagggg        60
     atgaaggatg gcagcctggc gcgcgatgca tttgtgcact atctgcggca ggattacgtg       120
     ttcctgatcc actttgcccg cgcctgggcg ctggccgtgg tcaagggcga aacccatgcc       180
     gagatgctgg ccgccgttgg cactgtcaac acgctggtgg tcgaggaaat gcagctgcat       240
     gtcggtgtgt gcgaggcggc cgggatctcg aaggacgcgc tgttcgccac gcccgagcga       300
     cccgaaaacc tcgcctatac ccgcttcgtg ctcgaggccg ggtatagcgg cgatctggcc       360
     gatctgctgg cggcgctggc gccctgtgtc atgggctatg gcgagatcgg cgcgcggctg       420
     gcgacagagg ccaccagcga ggcctacaag gactggatcg acacctatgc agggcccgag       480
     tatcaagccg cgtgcaaggc ggtgggcgag ttgatggatc aggctctgac aaggcgtatc       540
     ggcgcggatt tcgaagcctc tccacgatgg gagcgcctgt gccggacctt tcgcaccgcg       600
     accgagctag aggtcggttt ctggcagatg gggttgaccc cgtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page