(data stored in ACNUC7421 zone)

EMBL: CP000031.PE510

CP000031.PE510       Location/Qualifiers
FT   CDS_pept        514528..515244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC50629.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93835"
FT                   /db_xref="GOA:Q5LW25"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW25"
FT                   /protein_id="AAV93835.1"
FT                   /translation="MNDMSDWKPKRFWKQAAVAETAEGYAVELDGRPVRTPAKAPLLLP
FT                   TRALAEAIAAEWDAQESEVDPINMPFTRTANAAIDKVRIQQAEVADMLAAYGDSDLLCY
FT                   RADSPAELVELQAQTWDPALDWAAETLGVRLRPVQGVMHQPQPASAIETLTRKVHALNP
FT                   FQLAAFHDLVSLSGSLVLGFAAALNWRKADEIWQISRLDETWQEEQWGPDDEARALAAV
FT                   KRAAFLHAKAAYDIST"
     ttgaacgaca tgagcgactg gaaaccgaaa cgcttctgga aacaggctgc cgtggccgaa        60
     acggccgaag gttatgcggt ggaactggac ggccgcccgg tgcgcacccc ggccaaggcg       120
     ccgctgctgt tgccgacccg cgcattggcc gaggcgatcg ccgcggaatg ggacgcgcag       180
     gagagtgagg tcgatccgat caacatgccc tttacccgaa ccgccaacgc ggccatcgac       240
     aaggtgcgca tccagcaggc cgaagtcgct gacatgctgg cggcctatgg cgattcggat       300
     ctgttgtgct atcgggcgga ttccccggcc gaattggtcg aactgcaggc gcaaacctgg       360
     gacccggcgc tggattgggc tgccgaaacc ctcggtgtgc gactgcgtcc ggtccaaggg       420
     gtgatgcacc agccgcaacc cgcctccgcc atcgagacac tgacgcgcaa ggtgcatgcg       480
     ctgaacccgt tccagctggc ggcctttcac gatctcgtca gcctgtcggg ttcactggtc       540
     ctgggctttg ccgcggcgct gaattggcgc aaagcggacg aaatctggca gatttcgcgc       600
     ctcgacgaga cctggcaaga ggaacaatgg ggtcccgatg acgaagcgcg ggcgctggcc       660
     gccgtgaaac gcgcggcgtt cctgcatgcc aaggcagctt atgatatctc gacatga          717
//

If you have problems or comments...

PBIL Back to PBIL home page