(data stored in ACNUC9435 zone)

EMBL: CP000031.PE512

CP000031.PE512       Location/Qualifiers
FT   CDS_pept        516592..517860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0520"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transporter, permease protein"
FT                   /note="identified by similarity to SP:Q52664"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93837"
FT                   /db_xref="GOA:Q5LW23"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW23"
FT                   /protein_id="AAV93837.1"
FT                   /translation="MTTLTDPPKEQFRLSMLLYDTRYRSATIQVIAMIGFMLLAAWLIS
FT                   NTAQNLAALGKPIDFGFFSEPASYDINQRLLDYSSRDTHLRAAFIGLLNTLVVAVLGCI
FT                   TATVLGVIIGVLRLSNNWIVARLMTIYVEGFRNVPVLLWIVFIMAILIETLPAPRAFRG
FT                   DDATASMMLNDSVAVTNRGVYIPDALFSNSLGNVHLFGESSLRFDISLDLMLILIVLGG
FT                   SLWVSNFLRKRADRIQEQTGDRPVTWWQRLAVVVLPTGLVLVLLGFHLGYPELKGFNFQ
FT                   GGTHLRNSLIALWLALSLYTAAFIAEIVRAGILAISKGQTEAASALGLRSNKIMSLVIL
FT                   PQALRVIIPPLISNYLNLTKNSSLAIAVGYMDITGTLGGITMNQTGRELETILLLMLVY
FT                   LTISLSISAVMNWYNESVKLKER"
     atgacgactc tcactgaccc gccgaaggag cagttccggc tgtccatgct cctttatgat        60
     acgcggtacc ggtcggccac tatccaggtc attgcgatga taggcttcat gctgctggca       120
     gcatggctca tcagcaatac cgcccaaaac ctggctgccc tgggcaagcc catcgatttc       180
     ggcttcttca gcgagccggc cagctacgac atcaaccagc ggctgctgga ctactcctcg       240
     cgagacacgc acctgcgggc ggcctttatc ggactgctca acacgcttgt cgtggcggtg       300
     ctgggctgta tcaccgccac cgttctgggc gtgatcatcg gcgttctgcg cctgtccaac       360
     aactggatcg tcgcccgtct gatgacgatc tatgtcgaag ggttccgcaa cgttccggtc       420
     ctgctgtgga tcgtgttcat catggcgatc ctgatcgaga ccctgcccgc gccgcgcgcg       480
     ttccggggcg atgacgccac cgccagcatg atgctgaacg acagcgtggc cgtcaccaac       540
     cgcggcgtct atatccccga cgccctgttt tccaacagtc tgggcaatgt ccacctgttc       600
     ggcgaaagca gcctgcggtt tgatatcagc ctcgatctga tgctgatcct gatcgttctg       660
     ggcggcagcc tgtgggtgtc gaatttcttg cgcaagcgcg ccgaccgcat tcaggaacag       720
     accggcgacc gtccggtgac ctggtggcag cgtctggccg tggtggttct tccgaccggg       780
     ctggtgctgg tgctgctggg cttccatctt ggctatcccg agctcaaggg cttcaacttc       840
     cagggcggta cccatctgcg caactcgctg atcgcgctct ggctggcgct gtcgctctat       900
     accgccgcct tcatcgccga gatcgtgcgg gccggtatcc tggcgatttc gaagggccag       960
     accgaggcgg catccgcgct ggggctgcgc tcgaacaaga tcatgtcgct ggtgatcctg      1020
     ccgcaggcgc tgcgggtgat cattccgccg ctgatctcga actatctcaa cctcaccaag      1080
     aactcgtcac tggcgatcgc cgtgggttac atggatatca ccggcacgct gggcggtatc      1140
     accatgaacc agaccggtcg cgagctggag acgatcctgc tcttgatgct ggtgtacctg      1200
     accatctcgc tgtccatttc ggcggtgatg aactggtaca atgaatccgt caaactgaag      1260
     gagcgttga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page