(data stored in ACNUC7421 zone)

EMBL: CP000031.PE513

CP000031.PE513       Location/Qualifiers
FT   CDS_pept        517862..519175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0521"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transporter, permease protein"
FT                   /note="identified by similarity to SP:Q52665"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93838"
FT                   /db_xref="GOA:Q5LW22"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW22"
FT                   /protein_id="AAV93838.1"
FT                   /translation="MSDIGFVRTEMLPEREPPASTVGALGWARANLFSNWFNSVLTLAS
FT                   LYAVFAILAAVLPWIFSPTWNGTSLSNCREILTAAGSVGDHGTSGACWGVIRERWIQLL
FT                   FGFYPSELYWRPILAFILLGVALAPVLFSDKMPSKMLIFSGLYPFIFPWLLWGGTIWGP
FT                   IAALLGFVLGWVIYSAVSKTMSSLIGILLGAAAALVWWLVLAGFFVGVFDSVLAIGIEA
FT                   VESRKFGGFMLSITIGVVAIACSLPLGIVLALGRQSDLLIVKYICVGFIEFIRGVPLIT
FT                   LLFVASTLLNIFMPPGTNFDIILRVLIMVTLFAAAYMAEVIRGGLAALPKGQYEGADSL
FT                   GLNYWQAQRLIIMPQALKISIPGIVSTFIGVFKDTVLVSIIGLLDPLGLSNAIRADANW
FT                   NGIVWEIYGFIALIFFVFCFGMSRYSMYLERKLHTGHR"
     atgtctgaca tcggatttgt ccgcaccgaa atgctccccg agcgtgaacc gccggcctcg        60
     accgtcggcg cgctgggctg ggcacgtgcc aacctgttct cgaactggtt caacagcgtt       120
     ctgacgctgg cctctctcta tgcggtcttt gcgatccttg cggccgttct gccctggatt       180
     ttctcgccca catggaacgg gacttcgctc agcaattgtc gcgagatcct gacggctgcc       240
     ggatcggttg gtgatcacgg tacctcgggc gcctgctggg gcgtcattcg cgagcgctgg       300
     atccagctgt tgttcgggtt ctatccgtcc gagttgtact ggcggccgat cctggccttc       360
     attctgctgg gcgtggccct ggcgccggtc ctgttctctg acaagatgcc gtcgaagatg       420
     ctgatcttct cgggtctcta tccgttcatc ttcccctggc ttctgtgggg gggcaccatc       480
     tggggcccga ttgcggcgct gttgggcttt gtgctgggct gggtgatcta ctcggctgtc       540
     agcaagacga tgagcagcct gataggcatc ctgctgggcg cggcagctgc cctggtctgg       600
     tggctggtct tggccggctt tttcgtgggc gtcttcgact ctgtcctggc aatcggcatc       660
     gaagcggtcg aaagccgcaa gttcggtggc ttcatgctgt cgatcaccat cggtgttgtc       720
     gccattgcct gttcgctgcc gctgggcatc gtgctggcgc tgggacgcca gtcggacctg       780
     ctgatcgtca agtatatctg cgtgggcttt atcgagttca ttcggggtgt gccgctgatc       840
     acgctgttgt tcgtggcctc gaccctgctg aacatcttca tgccacccgg aaccaacttc       900
     gacatcatcc tgcgggtgct gatcatggtg acgctgttcg ccgcggccta tatggccgag       960
     gtgatccgcg gaggtctggc cgccctgccc aagggccagt acgagggggc ggattcgctt      1020
     ggcctcaact actggcaggc gcagcgcctg atcatcatgc cacaggcgct caagatctcg      1080
     atccccggca tcgtctcgac cttcatcggt gtgttcaagg acaccgtgct ggtctcgatc      1140
     atcgggcttc tcgatccgct gggtctgtcg aacgccattc gcgcggacgc caactggaac      1200
     ggaattgtct gggaaatcta cggtttcatc gccctgattt tcttcgtctt ctgcttcggc      1260
     atgtcccgct attccatgta tctggagcgc aagctccaca ccggccatcg ttaa            1314
//

If you have problems or comments...

PBIL Back to PBIL home page