(data stored in ACNUC7421 zone)

EMBL: CP000031.PE514

CP000031.PE514       Location/Qualifiers
FT   CDS_pept        519186..519977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0522"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:Q52666"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93839"
FT                   /db_xref="GOA:Q5LW21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW21"
FT                   /protein_id="AAV93839.1"
FT                   /translation="MSELAIDREIDRSKMQVSDEVAIEITNMNKWYGAFHVLRDINLTV
FT                   YQGERIVIAGPSGSGKSTLIRCLNALEEHQQGKIVVDGTELSNDLKNIDKIRSEVGMVF
FT                   QHFNLFPHLTILENCTLAPIWVRKTPRKEAEETAMHFLEKVKIPEQALKYPGQLSGGQQ
FT                   QRVAIARSLCMRPRIMLFDEPTSALDPEMIKEVLDTMIELAEEGMTMLCVTHEMGFARQ
FT                   VANRVIFMDAGQIVEQNEPEEFFNNPQSERTKLFLSQILGH"
     atgtctgaac tcgcaatcga tcgtgaaatc gaccgttcga aaatgcaggt gagcgacgag        60
     gtcgccatcg aaatcacgaa catgaacaag tggtacgggg ccttccacgt gctgcgtgac       120
     atcaacctga ccgtctacca gggcgagcgg atcgtgatcg cgggcccctc gggctcgggc       180
     aagtcgaccc tgatccgctg cctgaacgcg ctggaggaac accagcaggg caagatcgtg       240
     gtcgacggga ccgagctgtc caacgacctc aagaacatcg acaagatccg gtccgaggtc       300
     gggatggtgt tccagcactt caacctgttc ccgcatctga ccattctgga gaactgcacg       360
     ctggccccga tctgggtgcg caagacgccc cgcaaagagg ccgaggaaac ggcgatgcat       420
     ttcctggaaa aggtcaagat ccccgaacag gccctgaaat acccgggtca gttgtcgggc       480
     ggccagcagc agcgggtggc aattgcccgg tcgctgtgca tgcgcccgcg catcatgctg       540
     tttgacgaac cgacctcggc gcttgacccc gagatgatca aggaagtgct cgacaccatg       600
     atcgagctgg ccgaggaagg catgaccatg ctctgcgtga cgcacgagat gggctttgcg       660
     cgtcaggttg ccaaccgcgt catctttatg gatgcgggcc agatcgtgga acagaacgag       720
     ccggaagagt tcttcaacaa cccgcaaagc gagcggacca agctgttcct gagccagatc       780
     ctgggccact ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page