(data stored in ACNUC7421 zone)

EMBL: CP000031.PE517

CP000031.PE517       Location/Qualifiers
FT   CDS_pept        complement(521164..521958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0525"
FT                   /product="sterol desaturase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93842"
FT                   /db_xref="GOA:Q5LW18"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW18"
FT                   /protein_id="AAV93842.1"
FT                   /translation="MENESLVRLAMFVGLFVLFAIAERLAPRRMVHPRRPRRWLTNLTI
FT                   SVLNTVTLRALAVGLPLLAVGAALDASALGWGLFNHLGWPGWVEVLLAVLILDFAIWGQ
FT                   HLITHKIPLLWRLHRVHHADTDIDVTTAIRFHPVEIALSMLLKIGLVYLLGPSALAVIL
FT                   FEILLNGTALFNHSNLRLPLALDAVLRKVLVTPDMHRVHHSVLREEHDSNYGFALSIWD
FT                   RMMGTYVAQPAKGHDEMTIGLAWQDDRPTRLGWSLLLPFRRR"
     atggaaaacg agagccttgt ccggctggcg atgtttgtcg gcctttttgt cctgtttgcg        60
     attgccgagc ggctggcccc gcgccggatg gttcatccac ggcgcccgcg acgctggttg       120
     accaacctga cgatatcggt gctgaacacc gtgaccctgc gcgccctggc ggtgggccta       180
     ccgcttctgg ctgtgggtgc ggcgctggac gccagcgcgc tgggctgggg cctgttcaac       240
     catctgggct ggcccggctg ggtcgaagtg ctgctggccg tcctgatcct tgatttcgcc       300
     atctggggcc agcacctgat cacccacaag ataccgctgc tctggcggct acaccgggtg       360
     catcacgccg ataccgatat cgacgtcacc accgcgatcc ggtttcatcc ggttgaaatc       420
     gcgctgtcga tgctgctcaa gatcggcctt gtctacctgc tgggcccttc ggcgctggcg       480
     gtgatcctgt tcgagatcct gttgaacggc actgccctgt tcaaccactc caatcttcgc       540
     ttgccgcttg cgcttgacgc cgtgttgcgc aaggttctcg tcacccccga catgcaccgg       600
     gtgcaccatt cggtgctgcg cgaggaacat gacagcaatt acggctttgc cttgtcgatc       660
     tgggaccgga tgatgggaac ctatgttgca cagcccgcca agggccatga cgaaatgacc       720
     atcgggctgg catggcagga cgaccggccc acgcggttgg gatggagcct gctgctgccg       780
     tttcgccgcc gatga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page