(data stored in ACNUC9435 zone)

EMBL: CP000031.PE52

CP000031.PE52        Location/Qualifiers
FT   CDS_pept        51960..52751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0052"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93383"
FT                   /db_xref="GOA:Q5LWK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK5"
FT                   /protein_id="AAV93383.1"
FT                   /translation="MPDLSHRDRARGRFLADGVDPVTPAPAITVAGSASIDGARLFAPL
FT                   TLTLEAAQWTCLLGGSGVGKSTVLRLIAGLETGAEFSGAITASDDAPVLKRVAYMAQDD
FT                   LLLPWATVAQNVGLGARLRGEQVDRARLDDLLRRVRLTAHAAKRPAELSGGQRQRVALA
FT                   RTLMEDKPVVLLDEPFSALDARTRADMQELAAELLAGRTVLLVTHDPAEAARLGHSIQV
FT                   MTAAGLTPVAPPTAQIPRAVDDAATLECQAALLRMLREGVQ"
     gtgccggacc tttcgcaccg cgaccgagct agaggtcggt ttctggcaga tggggttgac        60
     cccgtgactc cggcccccgc gatcaccgtt gccggcagcg ccagcatcga cggcgcgcgc       120
     ctgtttgcgc cgctgaccct gacattggag gcggcgcaat ggacctgcct gctggggggg       180
     tcgggcgttg gaaagtcgac ggtgctgcgg ctgattgcgg ggctggaaac cggggcagag       240
     ttcagcggtg ccattaccgc atcggacgat gcgccggtgt tgaaacgggt ggcctatatg       300
     gcgcaggacg acctcttgtt gccctgggcc acggtggcgc agaacgtggg cttgggcgcg       360
     cggttgcggg gcgaacaggt ggaccgggcc cggctggacg acctgctgcg ccgggtgcgg       420
     ctgaccgctc acgccgccaa gcgtccggca gagctgtccg gtggccaacg ccagcgggtg       480
     gcgcttgcgc gtaccttgat ggaggacaag cccgttgtgc tgctggacga gcctttctcg       540
     gcgctcgatg cccgcacgcg tgcggatatg caggagctgg ccgccgagct attggccggg       600
     cgaaccgtgc tgctggtgac gcacgacccg gccgaggccg cacggctggg ccattcgatc       660
     caggtgatga ccgccgcagg gctgacgccg gtggcgccgc cgacggcaca gataccgcgc       720
     gcggtggatg acgcggcgac gctggaatgt caggccgcgc tgctcaggat gctgcgggag       780
     ggtgtgcaat ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page