(data stored in ACNUC7421 zone)

EMBL: CP000031.PE520

CP000031.PE520       Location/Qualifiers
FT   CDS_pept        complement(523761..525158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0528"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93845"
FT                   /db_xref="GOA:Q5LW15"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW15"
FT                   /protein_id="AAV93845.1"
FT                   /translation="MADSQTNARGTMHPLAQKFYFAAWRWHFYAALYVIPFLLILAVTG
FT                   LMMMFITQFDGRDGEKIAVQPQSTELSFDAQSAAVLQAQPGTIVEWIGPKAPDLAAVFR
FT                   VKTPEGQRLVALDQYSGEVLSIWDRRAGWYDLADNIHSTLLIGDLGDRLIEIAAGLGIV
FT                   LILTGLYIWWPRDNAMSALVPNLRARGRALWKSLHAVTGFWISALLLVFLVSGLSWAGI
FT                   WGGKLVQAWSTFPAEKWDNVPLSDDVHASMNHGHTNDVPWALEQTPLPASGSEAGVTGL
FT                   PEGQPVSAENLIALGRAMGMEGRFRLAYPAGGTGVWTINRDSMSGDSDDPFIDRTIHVD
FT                   QYTGKVLADVRYDDYSWAGKAMAVGVPFHMGLMGGWNFALNIVFCLSVIFLCVSGVVMW
FT                   VKRRPARSLRLAAPPEPADMPMWKGAALVAVLVSLMFPLAGLALIAALAFDVLILSNIP
FT                   ALRRALA"
     atggctgaca gccaaaccaa tgcccggggc accatgcacc cgctggcaca gaaattctat        60
     ttcgccgcgt ggcgctggca tttctacgcc gcgctctacg tgatcccctt tctgctgatc       120
     cttgcggtga ccgggctgat gatgatgttc atcacccagt tcgatggccg cgatggcgag       180
     aagatcgccg tgcagccgca atcaaccgag ttgtcctttg acgcgcaaag cgccgcggtg       240
     ctgcaggcac agcccggcac catcgtcgag tggatcggcc ccaaggcccc cgatctggcc       300
     gccgtgttcc gggtcaagac ccccgaaggc cagcgcctcg tcgcgctaga ccagtatagc       360
     ggcgaggtgc tgtcgatctg ggaccgccgc gcgggctggt acgatctggc cgacaacatc       420
     cattcgaccc tgttgatcgg tgatctgggc gaccgcctga tcgagatcgc cgcagggctg       480
     ggcatcgtgt tgatcctgac cggcctctat atctggtggc cgcgggacaa tgcgatgtct       540
     gcgctggtgc ccaacctgcg cgcacgcggt cgcgccctgt ggaaaagcct gcatgcggtc       600
     accgggttct ggatctcggc cctgctcttg gtgttcctgg tttcgggcct gtcctgggcc       660
     ggcatctggg gcggcaagct ggtgcaggcc tggtcgacct ttccggccga gaaatgggac       720
     aatgtccccc tgtcggacga tgtgcatgcc agcatgaacc acggccatac caatgacgtg       780
     ccttgggcgc tggaacagac accgctgccc gcctcaggct ccgaggccgg tgttaccggc       840
     ctgcccgagg gccagccggt cagcgccgag aacctcatcg cgctcggccg tgccatgggg       900
     atggaggggc ggttccgcct ggcctatccg gcgggcggaa ccggggtctg gaccatcaac       960
     cgcgacagca tgagcggcga ttccgatgac ccgttcatcg accgcaccat ccatgtcgat      1020
     caatacaccg gcaaggtgct ggccgatgtg cgctatgacg attactcgtg ggcgggcaag      1080
     gcgatggcgg taggcgtccc ctttcacatg gggctgatgg gcggctggaa cttcgcgctc      1140
     aacatcgtgt tctgcctgtc ggtgatcttc ctctgcgtct cgggcgtggt gatgtgggtc      1200
     aagcgccgcc cggcgcggtc gctgcggctg gccgcaccgc ccgaacccgc cgacatgccg      1260
     atgtggaagg gcgccgccct ggtggcggtg ctggtgtcgc tgatgttccc gctggcgggg      1320
     ctggcattga tcgcggcgct ggcctttgac gtgctgatcc tgagcaacat ccccgcgctc      1380
     cggcgcgcgc tggcctga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page