(data stored in ACNUC9435 zone)

EMBL: CP000031.PE521

CP000031.PE521       Location/Qualifiers
FT   CDS_pept        complement(525224..525592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0529"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93846"
FT                   /db_xref="GOA:Q5LW14"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW14"
FT                   /protein_id="AAV93846.1"
FT                   /translation="MTFLTHFSAVLSLLAVVLTSAIPQGWMPMRKDDRILLVICTEEGE
FT                   ARQWVDLAPDSPAHEDESDARPSCHFGGLNQVAILAQPPLLMTLNHAQRTRWDNLDFTH
FT                   RSAGFFPLYDARGPPHLS"
     atgacattcc tgacgcattt ctctgctgtc ctgtccctgc ttgcggtggt gctgaccagc        60
     gcaatcccgc agggctggat gccaatgcgc aaggacgacc ggatcctgct ggtgatctgc       120
     accgaagagg gggaagcccg gcaatgggtc gaccttgccc ccgacagccc ggcccatgaa       180
     gacgaaagcg acgcgcggcc aagctgccat ttcggcgggc tgaaccaggt cgcaatcctg       240
     gcccagccgc cgctgctgat gacactgaac catgcccagc gcacccgctg ggacaatctg       300
     gacttcaccc atcgcagcgc cgggttcttt cccctctacg acgcgcgcgg gccacctcac       360
     ctctcctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page