(data stored in ACNUC7421 zone)

EMBL: CP000031.PE522

CP000031.PE522       Location/Qualifiers
FT   CDS_pept        complement(525589..526242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0530"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93847"
FT                   /db_xref="GOA:Q5LW13"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW13"
FT                   /protein_id="AAV93847.1"
FT                   /translation="MTALPFPVAEEPDAFTAETGRKLFAGPSEFVKGVVAMSGLPPADR
FT                   VEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINFFTQGPELYLVDLPGYGYA
FT                   NAPLKVVEKWQKLLKQYLSGRQTLRRAFVLIDARHGVKAVDDEIMKLLDTSAVTFQCVL
FT                   TKADKVKAAERDKVLAQVRAALAKHPAAYPEIVLTSSEKGDGIATLRSIIAHLE"
     atgaccgccc tgccctttcc cgttgccgaa gagccggatg cgtttaccgc cgagaccggg        60
     cgcaagctgt tcgcgggccc gtccgaattc gtcaagggcg tggtggcgat gtcgggcctg       120
     ccccccgccg accgggtcga agtctgcttc gccggccgct cgaacgtggg caaatccagt       180
     ctgatcaacg cgctgaccgg caccaagggg ctggcgcgcg cgtcgaacac gccagggcgc       240
     acgcaagaga tcaacttctt cacccagggg cccgagctct atctggtcga cctgccggga       300
     tacggctatg ccaatgcgcc gctgaaagtg gtcgagaaat ggcagaagct gctgaaacag       360
     tatctcagcg gtcgtcagac cctgcgccgc gcctttgtgc tgattgacgc gcgccatggg       420
     gtcaaggcgg tcgatgacga gatcatgaag ctgctcgaca ccagcgcggt gacctttcaa       480
     tgcgtgctga ccaaggccga caaggtcaag gccgccgagc gcgacaaggt gctggcgcag       540
     gtgcgcgcag cattggccaa acaccccgcc gcctatccgg aaattgtatt gacctcgtcg       600
     gaaaagggcg atggtatcgc gactctaagg tccatcatcg cccatctgga atga             654
//

If you have problems or comments...

PBIL Back to PBIL home page