(data stored in ACNUC7421 zone)

EMBL: CP000031.PE524

CP000031.PE524       Location/Qualifiers
FT   CDS_pept        complement(526973..528802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0532"
FT                   /product="inner membrane protein YidC, putative"
FT                   /note="identified by similarity to SP:P25714"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93849"
FT                   /db_xref="GOA:Q5LW11"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW11"
FT                   /protein_id="AAV93849.1"
FT                   /translation="MDDQNKNLILATALSFLVILVWFILFPPPEQTEAPATEIATTNGT
FT                   AVQTPTAAATEGGAGEVPALDSAAPTQAEAPRVQIDTPRLKGSVSLLGGRIDELSLKDY
FT                   RVSLDEDAEIVEMLTPAGSTSAYYALYGWAPGAGLNAADVPGPLTEWSLESGDTLSVGT
FT                   PVTLSWSNGSGVTFRRTLAVDEDYMFTVTQSVENGSAAPIGAAPYGILARHGIGEDADL
FT                   PGLKNFFILHEGVVAMNDGTLSEIDYKDVRKFDIDPNEGAQAEVFQNKSDGWIGFTDHY
FT                   WMATLIPGSGTAFKSAAKYDARRKIYQAETVLPTMSVAPGESAEVTTRLFAGAKEWESI
FT                   RAYQQDGVQKFLDSIDWGWFFFLTKPIFWLLHQINGLIGNMGWSIIGLTLIIKAIVFPL
FT                   ALKSYVSMAKMKELQPQMEALKEAAGDDRQKMQQGMMELYKKEKVNPAAGCLPILLQIP
FT                   IFFSLYKVIFVTIELRQAPWFGPFRDLSMPDPTSIMNFFGWLPWAGPEAGSLTATILIG
FT                   ILPLLLGISMWLQQKLNPAPTDPTQAMIFAWMPWVFMFMLGSFASGLVVYWIANNTITF
FT                   TQQYIIMRSHGYKPDVFGNIKSGFARRAKADKK"
     atggacgatc agaacaagaa tctcatcctc gcaacagcgc tcagctttct ggtgatcctg        60
     gtctggttca tcctgttccc gccgccggaa cagaccgagg cgcccgcgac cgagatcgca       120
     accaccaacg gcaccgccgt gcagaccccc accgccgccg cgaccgaagg tggcgccggc       180
     gaagtgcccg cgctcgacag cgctgccccg acccaggccg aagcgccgcg ggtccagatc       240
     gacacgccgc gcctgaaggg cagcgtctcg ctgctgggcg gccgcatcga cgagctgtcg       300
     ctgaaagact atcgcgtctc gctcgacgaa gacgcagaga ttgtcgagat gctgacaccg       360
     gccggatcca cctcggccta ttacgcgctt tatggctggg cccccggtgc cgggctgaac       420
     gcggccgacg tgcccgggcc gctgaccgaa tggtcgctgg agtccggcga cacattgagc       480
     gtgggcaccc ccgtcaccct gagctggtcc aatggtagcg gcgtcacctt ccgccgcacc       540
     ctggcggtgg acgaggacta tatgttcacc gtcacccagt cggtcgagaa cggctccgcc       600
     gccccgatcg gtgccgcgcc ctatggcatc ctggcccgtc acggcatcgg cgaggatgcc       660
     gatctgcccg ggctgaagaa cttcttcatc ctgcacgagg gcgtcgtcgc catgaatgac       720
     ggcaccctgt cggaaatcga ctacaaggat gtgcgcaagt tcgacatcga ccccaacgag       780
     ggcgcgcagg ccgaagtgtt ccagaacaag tccgacggct ggatcgggtt caccgaccat       840
     tactggatgg cgaccctgat ccccggatcg ggcaccgcgt tcaaatcggc ggcaaaatat       900
     gacgcccggc gcaagattta tcaggccgaa accgtgctgc cgaccatgag cgtggcgccg       960
     ggcgaaagcg ccgaggtgac cacccgcctg ttcgccggcg ccaaggaatg ggaaagcatc      1020
     cgcgcctatc agcaggacgg cgtgcagaaa ttcctcgaca gcatcgactg gggctggttc      1080
     ttcttcctga ccaagccgat cttctggctg ctgcaccaga tcaacgggct gatcggcaac      1140
     atgggctggt cgatcatcgg cctgaccctg atcatcaagg cgatcgtctt cccgctggcg      1200
     ctgaaatcct atgtctcgat ggccaagatg aaggagcttc agccgcagat ggaggccctg      1260
     aaagaggccg ccggcgacga ccgccagaag atgcagcagg gcatgatgga actttacaag      1320
     aaggaaaagg tgaacccggc cgccggctgt ctgccgatcc tcttgcaaat cccgatcttc      1380
     ttctcgctct acaaggtgat ctttgtcacc atcgaactgc gtcaggcccc gtggttcggc      1440
     ccgttccgcg acctcagcat gccggacccg acctcgatca tgaacttctt cggctggctg      1500
     ccctgggccg ggcccgaggc gggctcgctg acggcgacca tcctgatcgg tatcctgccg      1560
     ctgcttctgg gcatctcgat gtggctgcaa cagaaactca atccggcgcc caccgacccg      1620
     acccaggcga tgatctttgc ctggatgccc tgggtgttca tgttcatgct gggcagcttt      1680
     gccagcggcc tggtggttta ctggatcgcg aacaacacga tcacctttac ccagcagtac      1740
     atcatcatgc gcagccacgg gtacaaaccg gacgtgttcg gaaacatcaa gtccggcttt      1800
     gcccgcagag ccaaggcgga caagaaatga                                       1830
//

If you have problems or comments...

PBIL Back to PBIL home page