(data stored in ACNUC7421 zone)

EMBL: CP000031.PE527

CP000031.PE527       Location/Qualifiers
FT   CDS_pept        complement(531470..532399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0535"
FT                   /product="K+-dependent Na+/Ca+ exchanger related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93852"
FT                   /db_xref="GOA:Q5LW08"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW08"
FT                   /protein_id="AAV93852.1"
FT                   /translation="MEYLSIAAGLIGLFLGGEALVRGSVGLAQRLGLPPLLIGLTVVGF
FT                   GTSTPELLVSVDAALRGVPDIALGNILGSNIANILLIGGITSLIWPIRGKPVGLWRDLT
FT                   VMILATLALTPILLGGQVIRVVGLVLLLSLVAYLVWSYRQAGGPCAEDTETDLPDVPAR
FT                   PFVAPALIGAGLLGLMIGARLLVDGAVSVAQGLGVSDAFIGLTIVAVGTSLPELATSVI
FT                   AAYRRQSEIAVGNIVGSNIFNVLGILGATAVIAPIPVASRFALFDLPVALAAAVTFSVL
FT                   LLWRAGVSRGAGVLLLLAYAAYVWAAQG"
     ttggaatacc tctctatcgc cgccgggctg atcggtctgt ttctaggggg cgaggcattg        60
     gtgcgtggca gcgtcgggct ggcccagcgc ctgggcctgc cgccgctgct gatcgggctg       120
     accgtggtcg gctttggcac ctccacgcct gaattgctgg tttcggtcga tgcagcgctg       180
     cggggtgtac ctgatatcgc cctgggcaat atcctgggat cgaacatcgc caacatcctg       240
     ctgatcggag gcatcaccag cctgatctgg cccattcgcg gcaaaccggt cgggctgtgg       300
     cgtgatctga cggtaatgat attggcgacc ctcgcattga cgccgatact gctgggcggc       360
     caggtgatcc gggtcgtggg ccttgtgctg ctgctgtccc ttgtcgccta tctggtctgg       420
     tcctatcgac aagccggcgg cccttgcgcc gaggatacgg aaaccgacct ccccgacgtg       480
     cccgcccgcc cctttgttgc ccctgctctc attggcgcgg gcctgctggg cctgatgatc       540
     ggcgcgcggc tgctggtcga tggcgcggtc tcggtcgcgc aggggctggg tgtgtcggat       600
     gccttcatcg gtctgaccat cgttgccgtc ggcacctcgc tgcccgaact ggcgacctcg       660
     gtcatcgccg catatcgccg ccagtccgag atcgcggtgg gcaatatcgt aggttcgaac       720
     atcttcaacg ttctcggcat cctgggggcc accgccgtga ttgcgccgat tcctgtggcg       780
     tcgcgctttg ccctgttcga cctgccggtc gccctggccg ccgcggtcac cttcagcgtg       840
     ctgctcttgt ggcgcgcggg cgtcagccgc ggcgcagggg tgctgttgct gctggcctat       900
     gccgcctatg tctgggccgc gcagggctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page