(data stored in ACNUC7421 zone)

EMBL: CP000031.PE53

CP000031.PE53        Location/Qualifiers
FT   CDS_pept        52706..53482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0053"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93384"
FT                   /db_xref="GOA:Q5LWK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK4"
FT                   /protein_id="AAV93384.1"
FT                   /translation="MSGRAAQDAAGGCAMTRWLPAVAATLFALAIWQAVVSLTDLPRFI
FT                   LPGPVLVAETWWQSRWLIAEHTAVTALEVLIGLACGAVLGVATALQLASSRIARVLVQP
FT                   MLVFTQALPVFALAPILTLWLGYGLWSKVAMAVLIIYFPITAAFFDGLMRTPVGYLDLA
FT                   RTMQASPRAVLWHIRVPAALPQLASGLRLAAVYAPIGAVIGEWVGASKGLGYLMLLANG
FT                   RAKTDLMFAAMLTLGVLSVLLHLAMRRATRRMAGER"
     atgtcaggcc gcgctgctca ggatgctgcg ggagggtgtg caatgacacg ctggctcccc        60
     gctgttgcgg caaccctttt tgcgctggca atctggcagg cggtggtcag cctgaccgac       120
     ctgccgcgct tcatcctgcc ggggccggtg ctggtggccg aaacctggtg gcagagccgc       180
     tggctgatcg ccgaacatac ggcggtgacc gcgctcgagg ttctgatcgg tctcgcctgt       240
     ggcgcggtgc tgggtgtggc gacggcgttg cagctggcca gttcgcggat cgcgcgggtt       300
     ctggtgcagc cgatgctggt ctttacccag gcgctgccgg tctttgcgct ggctccgatc       360
     ctgacgctgt ggctgggcta tgggctgtgg tccaaggtcg ctatggccgt gctgatcatc       420
     tatttcccga tcacggcggc gtttttcgac gggctgatgc ggacgcctgt cggctacctc       480
     gaccttgccc gcaccatgca ggccagcccg cgcgcggtgc tttggcatat ccgagtgccg       540
     gcggcgctgc cgcaacttgc ctcgggcctg cggttggcgg cggtctatgc gccgatcggt       600
     gcggtgatcg gcgagtgggt gggcgcgtca aaggggctgg ggtatctgat gctgttggcc       660
     aatggacgcg ccaagaccga cctgatgttc gccgccatgc tgacgctggg cgtgttgtcg       720
     gttctgctgc atctggcgat gcggcgggcg acgcggcgga tggcgggcga gcgttaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page