(data stored in ACNUC9435 zone)

EMBL: CP000031.PE531

CP000031.PE531       Location/Qualifiers
FT   CDS_pept        533672..534469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0539"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93856"
FT                   /db_xref="GOA:Q5LW04"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW04"
FT                   /protein_id="AAV93856.1"
FT                   /translation="MAAWVCILGQMKPDPETKPDPMRQTAQPAPQRLLRHLPLIVIVLI
FT                   AVIGAITLRDYLSFDTLAANRQALLAYREAHYAALAAIFVATYVLIVAFSLPGAAVASM
FT                   TGGFLFGLAVGTVLNVVAATIGAVAIFLAARAGLGAMLTARLEASEGTVKRLKEGLRRN
FT                   EIEVLFLLRLVPAVPFFAANLIPALVGVKLRNYVLTTALGIVPGAIVFTWIGVGLGGVF
FT                   DRGESPDLSLFREPFVIGPILGLCLLAALPIAIKALRGKPEGE"
     ttggcggctt gggtctgcat cttggggcaa atgaaaccag acccagaaac aaagccggat        60
     ccgatgcgcc aaaccgccca acccgcgccg cagcgcctgc tgcgccatct gccgctgatc       120
     gtgatcgtgc tgatcgcggt gatcggggcc atcaccctgc gcgactatct cagctttgac       180
     acgctggcgg cgaatcgcca ggcgctgctg gcctatcgcg aggcgcatta cgctgcgctg       240
     gccgcgatct ttgtcgcgac ctatgtgctg atcgtggcct tttccctgcc cggtgctgcg       300
     gtcgcctcga tgaccggcgg attcctgttc ggtctggcgg tcggcaccgt gctgaacgtg       360
     gtcgccgcca caatcggggc ggtggcgatc tttctggccg cccgcgccgg gctgggggcg       420
     atgctgaccg cgcggctcga ggcctccgag ggcacggtca aacggctcaa ggaggggttg       480
     cggcgcaacg agatcgaggt gctgttcctg ctgcggctgg tgcctgcggt gccgttcttt       540
     gccgccaacc tgatcccagc gctggtgggg gtaaagctgc gcaactatgt gctgaccacg       600
     gcgctgggca tcgtgcccgg ggcgatcgtg ttcacctgga tcggggtggg gctgggcggc       660
     gtattcgacc gaggtgaaag ccccgatctg tcgctgttcc gggaaccctt cgtgatcggg       720
     ccgattctgg gtctgtgcct gctggcggcg ctgcccatcg cgatcaaggc cctgcgcggc       780
     aagccggagg gcgaatga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page