(data stored in ACNUC7421 zone)

EMBL: CP000031.PE533

CP000031.PE533       Location/Qualifiers
FT   CDS_pept        535901..537286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0541"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93858"
FT                   /db_xref="GOA:Q5LW02"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW02"
FT                   /protein_id="AAV93858.1"
FT                   /translation="MLNSLSGRFLILTVAFVMLAEVLIFVPSIARFRQDFLQNRLERAQ
FT                   IASLALLADDMLATDLETELLENAGVYNVVLRRDEVRQLMLSSPIPGQIGQSYDLRQAS
FT                   PWILMRDALLRFFMSENEVIRVIGEPVKEAGLLIEVTMDSQPLRMAMIDYGARILLLSL
FT                   VISIITAFFLFLAVRAILVRPIRGVVDYMQRYARAPEDVRGIITPNSGVTELREAEEAL
FT                   QMLQRQLTQALRQRERLAQLGGAVAKVSHDLRNILTSAQLFTDRIETSEDPLVRRMAPK
FT                   LVNSITRAVSLCESTLAFGRAEEPSPMLTMVRLHMVAEDVVASERLALGEGAIEIVNEV
FT                   PETLSARADPEQLFRVVMNLVRNARQALEATGQAGLVAVSGHETEADWVIEVRDTGPGL
FT                   PLKARENLFTPFQGGVRKGGSGLGLAISAELVRGHGGALVLKDSGPSGTAFEIRLPKGG
FT                   ETF"
     atgctgaact cgctttcggg ccggtttctg atcctgacgg tcgccttcgt gatgttggcc        60
     gaagtgctga tctttgtgcc ttcgatcgcg cggttccggc aggatttcct gcaaaaccgg       120
     ctggaacggg cgcagatcgc ctcgttggcg ctgctggcgg atgacatgct ggccaccgat       180
     ctcgagaccg agctgctgga aaacgccggt gtctataacg tggtgttgcg ccgcgacgag       240
     gtgcggcagc tgatgctcag ctctccgatt cccggccaga tcgggcagag ctatgatttg       300
     cgccaggcct cgccctggat cctgatgcgc gatgcgctct tgcgcttctt catgtccgag       360
     aacgaggtca tccgggtgat cggagaaccg gtaaaggagg ccggattgct gatcgaggtc       420
     acgatggaca gccaaccgct caggatggcg atgatcgact atggcgcgcg tatcctgctg       480
     ttgtcgctgg tgatctcgat catcaccgcc tttttcctgt tccttgcggt gcgggcgatc       540
     ctggtgcggc cgatccgggg cgtggtcgac tatatgcaac gctatgcccg tgcgcccgag       600
     gatgtgcggg gcatcatcac ccccaattcc ggcgtgaccg aactgcgcga ggccgaggaa       660
     gccctgcaga tgctgcaacg ccagctgacc caggcactgc gccagcgcga gcggctggca       720
     cagctgggcg gcgcggtggc caaggtcagc catgatctgc gtaatatcct gacttcggct       780
     cagctgttca ccgaccggat cgagacaagc gaggacccgc tggtgcgccg gatggcgccg       840
     aaactggtca actcgatcac gcgggcggtg tcgctgtgcg agagcacgct ggcctttggc       900
     cgggccgagg aaccctcgcc gatgctgacc atggtccgcc tgcatatggt ggccgaggat       960
     gtggtcgcca gcgagcggct ggcgctgggc gagggcgcga tcgagatcgt caacgaggtg      1020
     cccgagacgc tgagcgcgcg ggccgatccc gaacagctgt tccgggttgt tatgaacctg      1080
     gtgcgcaatg cacgtcaggc gctggaggcc accgggcagg ccggtctggt cgcggtttcg      1140
     ggccacgaga ccgaggcgga ttgggtgatc gaggtgcgcg ataccggccc gggactgccc      1200
     ctcaaggcgc gcgagaacct gttcaccccg ttccagggcg gtgtgcgtaa gggcggctcg      1260
     ggcctgggcc tggcgatttc cgccgaactg gtgcgtggcc atggcggtgc gctggttctg      1320
     aaagacagcg gcccgagcgg aaccgccttt gaaataaggc tcccgaaagg cggcgaaact      1380
     ttttga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page