(data stored in ACNUC7421 zone)

EMBL: CP000031.PE534

CP000031.PE534       Location/Qualifiers
FT   CDS_pept        complement(537802..539055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0543"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD14035.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93859"
FT                   /db_xref="GOA:Q5LW01"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW01"
FT                   /protein_id="AAV93859.1"
FT                   /translation="MNTAQPDFDLIVAGAGMVGMSAALYAQMDGLKVALCDPNPPGSGT
FT                   TYGSACTIATYACIPVNSPAIFAALPYLLTSKDSPLSFNLLHGLKNPCWMLSFLANCRA
FT                   ARVRRITEALGRFLADADAGLDPLIMAAGAEDLIVSNDCLYVWSTRAGYEGARASNALR
FT                   RAQGVRFEELGPDEVRAMEPNLKQPIHRGLHFKGARHVTSPQALVGRMQHRFETLGGTY
FT                   LPARVERCDPDEGGVTVRLNDGGTLRAGHFALTAGARSRQIAGTGAEGLPLGTERGYHI
FT                   LYRDHASLVSRPVGWAEAGFYATPMAQGLRIAGTVEINAIDAPFNTKRTDYLQRKSHEM
FT                   FGQLGAPDETWLGHRPTMPDSLPVIGPSPSSDRVIFAFGHQHIGLTLGGLTGKVVADLA
FT                   QQRSPTCNLGDFAPQRFT"
     gtgaacacag cccagcctga tttcgatctg atcgttgccg gtgcgggcat ggtcggcatg        60
     tccgccgcgc tctatgccca gatggatggg ctgaaggtgg cgctctgcga tccgaacccg       120
     cccggatcgg gaaccaccta tgggtcggcc tgcaccatcg ccacctatgc ctgcattccg       180
     gtcaacagcc cggcgatttt tgccgcattg ccgtatctgc tgaccagcaa ggacagcccg       240
     ctcagcttca acctgctgca cgggttgaag aacccgtgct ggatgctgtc ctttctcgcc       300
     aattgccgcg cagccagggt tcgaaggatc accgaggcgc tggggcggtt tctggccgat       360
     gccgatgcgg ggcttgaccc gttgatcatg gcagccgggg ccgaagacct gatcgtcagc       420
     aatgactgtc tctatgtctg gtcaacccgg gccggatacg agggcgcgcg cgccagcaat       480
     gcgctgcgtc gggcccaggg ggtgcgcttc gaggagcttg gcccggacga ggtgcgcgcg       540
     atggagccga acctgaaaca gcccattcac cgaggcctgc atttcaaggg cgcacgccat       600
     gtgaccagcc cgcaggccct ggttggccga atgcagcacc ggttcgagac actgggtgga       660
     acctacctgc ccgcccgggt cgagcgttgc gatcctgacg aaggcggcgt gacggtccgg       720
     ctgaacgacg gtggcacgct tcgcgccggg catttcgccc tcactgccgg ggcgcgctcg       780
     cggcagatcg ccggcaccgg tgccgaaggc ctgcctctgg gaaccgagcg cgggtaccat       840
     attctctacc gcgatcacgc cagccttgtg tcgcggccgg tcggctgggc cgaggccggg       900
     ttttacgcaa ccccgatggc gcaggggctg cgcatcgccg ggaccgtgga aatcaacgcc       960
     atcgacgcgc ccttcaacac caagcgtaca gattacctgc agcgcaaatc gcacgaaatg      1020
     ttcggccagc ttggcgcacc cgacgaaacc tggctggggc atcgcccgac gatgccggat      1080
     tcgctgccgg tgatcgggcc gtccccatcc tcggatcggg tgatatttgc ctttggtcac      1140
     cagcatatcg gcctgaccct gggcggtctg acgggcaagg tggttgccga tctcgcccaa      1200
     cagcgctcgc cgacatgcaa cctcggcgat tttgcgccgc aaaggttcac gtga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page