(data stored in ACNUC9435 zone)

EMBL: CP000031.PE537

CP000031.PE537       Location/Qualifiers
FT   CDS_pept        544149..544619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0546"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93862"
FT                   /db_xref="GOA:Q5LVZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ8"
FT                   /protein_id="AAV93862.1"
FT                   /translation="MFSHLRFFAHAGAVSRACRRGCNKELLRMKYTLSLHSRSSPFRIV
FT                   LEINGDPDSDSFHWTEIEPDHEKPFFMAASRSLGYFDNSAKHGEIKRAIFKGSGVATDK
FT                   RPPVLELQICRLPEFKIRDFEHCWQGNILRWADSPNYQKQSLQRFTWRAEAV"
     ttgttttctc atctacgctt ttttgcgcac gcaggggcgg tttcccgcgc ctgtcggcgg        60
     ggctgcaaca aggagctgct gcgaatgaag tacactctct cgcttcatag ccgatcctct       120
     cccttcagga tcgtactcga aatcaacggc gatcccgact cggatagctt ccattggacc       180
     gagatcgagc ccgaccacga aaaacccttc ttcatggccg cctccaggtc gcttggttat       240
     ttcgacaatt cagcaaagca tggtgagatc aagcgcgcca tattcaaggg ttcgggggtg       300
     gcgacggaca aacgcccgcc cgtgttggaa ctgcagatct gtcggcttcc ggaattcaag       360
     atcagggatt tcgagcattg ctggcaggga aacatcctca gatgggctga cagccctaat       420
     taccagaaac agtccctgca acgtttcacc tggcgagcgg aagccgtcta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page