(data stored in ACNUC9435 zone)

EMBL: CP000031.PE539

CP000031.PE539       Location/Qualifiers
FT   CDS_pept        545461..545724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0548"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93864"
FT                   /db_xref="GOA:Q5LVZ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ6"
FT                   /protein_id="AAV93864.1"
FT                   /translation="MRIAVFAISLAYVLLYGWAWVGTVNASMDAAGRGMALGFLTVGIG
FT                   ATAIFVIPALVLAIANRAPKWALGLSLAPAALLFLVVMTGVI"
     atgcgtatcg ccgtttttgc catctccctc gcctatgtcc tcctctatgg ctgggcctgg        60
     gtcgggaccg tcaacgcctc gatggatgcg gctgggcggg gcatggcgct tggatttctc       120
     accgtcggca ttggagccac cgcgattttc gtgatcccgg cgcttgttct ggcgatagcc       180
     aaccgcgcgc ccaaatgggc gctgggcctg tccctggccc ctgcggcctt gctgttcctg       240
     gtcgtgatga ccggggtgat ctga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page