(data stored in ACNUC7421 zone)

EMBL: CP000031.PE540

CP000031.PE540       Location/Qualifiers
FT   CDS_pept        complement(545732..546238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0549"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:G97668"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93865"
FT                   /db_xref="GOA:Q5LVZ5"
FT                   /db_xref="InterPro:IPR025690"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ5"
FT                   /protein_id="AAV93865.1"
FT                   /translation="MDHARRGDRPMSRLDSMLRRLTAQRDGLNWAALQISGIPGEVLDM
FT                   GLGNGRTYDHLREILPGRRIRVMDRVLQCHPSCTPPEADFLMGEAEPMLERLAAEGAPI
FT                   VLAHYDFGMGIKADDVAEAARLSPLIARVMVPGGLIISGQPLVGFTPVAAPDSIPPERY
FT                   LFYRA"
     atggaccatg cccgccgagg agaccgaccg atgagccgat tggattcaat gctgcgccgc        60
     ctgaccgcgc aacgggacgg gctgaactgg gctgcgcttc agatctccgg catcccgggc       120
     gaggtgctcg acatggggct gggcaacggg cgcacctatg accacctgcg cgagatcctg       180
     ccgggccgcc gcatccgggt gatggatcgg gtgctgcaat gccacccctc gtgcaccccg       240
     cccgaggcgg atttcctgat gggcgaagcg gaaccgatgc tggagcgtct ggccgccgag       300
     ggcgccccga tcgttctggc ccattacgat ttcggcatgg ggatcaaggc cgatgacgtg       360
     gccgaggccg ctcggctcag cccgctgatc gcccgtgtta tggtgcccgg cggcctgatc       420
     atctcgggcc agccgctggt cgggttcacc ccagtcgcag cccccgacag catcccgccc       480
     gaacgctacc tgttctaccg ggcctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page