(data stored in ACNUC7421 zone)

EMBL: CP000031.PE541

CP000031.PE541       Location/Qualifiers
FT   CDS_pept        complement(546205..546969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0550"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:E95936"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93866"
FT                   /db_xref="GOA:Q5LVZ4"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ4"
FT                   /protein_id="AAV93866.1"
FT                   /translation="MTPDWTPLDAELARWAAEGLTLPLWWRDDDAVSTTPQLDRLTALA
FT                   EDLDLPVHLAVIPAGADTALADHVTAHPHLVPVVHGWAHQNHVPATEKKAEFRAHRPLS
FT                   EILTEAGQGKARLQALFGDALRPMFVPPWNRIAPEVTAGLPPLGYRALSTATPRRSPMA
FT                   APGLAQVNTHLDPIDWRGSRGLVAPQTLIAQTATLLADRREGRADATEPFGILTHHLVH
FT                   DDEIWQFSGALLARLLAGPCQPWTMPAEETDR"
     atgaccccgg actggacccc actcgatgcc gaactggcgc gatgggcggc cgaggggctt        60
     accctgccgc tctggtggcg cgacgatgac gcggtgagca cgaccccaca gctggaccgg       120
     ctgaccgcgc tggccgagga cctggacctg cccgtgcatc tggcggtgat ccccgccggg       180
     gccgataccg cgctggctga ccacgtcacc gcgcatccgc atctggtccc ggtcgtgcat       240
     ggctgggcgc accagaacca cgtccccgcg accgagaaga aggccgagtt tcgcgcccac       300
     cgcccactgt ccgagatcct gaccgaggcc gggcaaggca aggcacggtt gcaggcactg       360
     tttggcgatg cgctgcggcc gatgttcgtg ccgccctgga accggatcgc gcccgaggtc       420
     accgccggcc tgcccccgct gggctatcgc gcgctgtcca ccgcaacccc gcgccgcagc       480
     ccgatggccg cgccggggct ggcgcaggtc aacacccatc tcgacccgat cgactggcgc       540
     ggcagccgcg gactggtggc gccgcagacc ctgatcgccc agaccgccac gctgctggcg       600
     gatcggcgcg aggggcgcgc cgatgccacc gagccctttg gcatcctgac ccaccatctg       660
     gtgcatgacg acgaaatctg gcagttctcc ggggcgctgc tggcgcggct gttggccggc       720
     ccctgccagc catggaccat gcccgccgag gagaccgacc gatga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page